| IED ID | IndEnz0005000748 |
| Enzyme Type ID | lipase000748 |
| Protein Name |
Selenium-binding protein 1 AtSBP1 |
| Gene Name | SBP1 At4g14030 dl3055c FCAALL.79 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MATETEVVAPVTVSNGGSKGCCKYGGPGYATPLAAMSGPSEKLIYVTAVYTGTGIDKPDYLATVDVDPSSPSYSSVIHRLPMPFVGDELHHSGWNSCSSCHGDASVDRRYLVLPSLISGRIYAIDTKENPRAPSLYKYVDPKEIADKTGLAFPHTAHCLATGEILVSCLGDEEGNAKGNGFLLLDSDFNIKNRWEKPGHSPLYGYDFWYQPRHKTMISTSWGAPKAFSKGFNLQHVADGLYGSHLHVYSWPGGEIKQLIDLGPTGLLPLEIRFLHDPSKDTGFVGSALSSNMIRFFKNSDETWSHEVVISVKPLKVENWILPEMPGLITDFLISLDDRFIYFVNWLHGDIRQYNIEDPKNPVLTGQIWVGGLLQKGSPVKAVGEDGNTFQFEVPQIKGKSLRGGPQMIQLSLDGKRLYATNSLFSAWDRQFYPEIMEKGSHIIQIDVDTEKGGLTINPDFFVDFGDEPDGPSLAHEMRYPGGDCTSDIWI |
| Enzyme Length | 490 |
| Uniprot Accession Number | O23264 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Binds cadmium and mediates lower sensitivity to stress requiring glutathione (GSH) for tolerance (e.g. cadmium, selenate, and hydrogen peroxide excess). Probably helps to detoxify cadmium potentially through direct binding (PubMed:18354042, PubMed:19710230). Binds selenium, cadmium, zinc and nickel in vitro (PubMed:25274629). {ECO:0000269|PubMed:18354042, ECO:0000269|PubMed:19710230, ECO:0000269|PubMed:25274629}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Initiator methionine (1); Modified residue (1); Mutagenesis (1); Sequence conflict (10); Site (2) |
| Keywords | Acetylation;Reference proteome;Selenium |
| Interact With | |
| Induction | INDUCTION: Induced by cadmium (at protein level) (PubMed:16502469, PubMed:18354042, PubMed:19710230). Induced by selenium (selenate), copper and hydrogen peroxide H(2)O(2) (at protein level) (PubMed:16502469, PubMed:18354042, PubMed:19710230). The induction in response to sulfur starvation is repressed by glutathione (GSH) (at protein level) (PubMed:19710230). {ECO:0000269|PubMed:16502469, ECO:0000269|PubMed:18354042, ECO:0000269|PubMed:19710230}. |
| Subcellular Location | |
| Modified Residue | MOD_RES 2; /note=N-acetylalanine; /evidence=ECO:0007744|PubMed:22223895 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12609038; 12644654; 15208337; 15247402; 16244144; 17828791; 18650403; 28627464; 29574326; |
| Motif | |
| Gene Encoded By | |
| Mass | 54,057 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |