| IED ID | IndEnz0005000754 |
| Enzyme Type ID | lipase000754 |
| Protein Name |
Short-chain dehydrogenase srdE EC 1.1.1.- Sordarial biosynthesis cluster protein srdE |
| Gene Name | srdE NCU02922 |
| Organism | Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Sordariomycetes Sordariomycetidae Sordariales Sordariaceae Neurospora Neurospora crassa Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) |
| Enzyme Sequence | MAPQSTKFALITGCGAGGIGEALILEYLRRGIHPIATLLPFESSEHLDKAGITWFKLDVTNEESVVQLKKDVSELTKGRLDFLVNNAGICYTMTAIDTDVKSVQRMFDVNLFGPMRMVHHFHDMLIASSGIIVNIGSIGGVVPFVYGSSYNASKAALAHWGNSLRVELAPLGVRVLVIISGEVGTNILKNDHGRTLPEGSYYSPMAEEFKNHVHRTPDAATDRFVYAKNVVGESLKKSPTTWFWTGSYSGVIRFLHTFFPKTVFDRWFSSLFNLAKLKEAHDAAMKKKVA |
| Enzyme Length | 290 |
| Uniprot Accession Number | Q7SHI2 |
| Absorption | |
| Active Site | ACT_SITE 150; /note=Proton acceptor; /evidence=ECO:0000255|PROSITE-ProRule:PRU10001 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 1.1.1.- |
| Enzyme Function | FUNCTION: Short-chain dehydrogenase; part of the gene cluster that mediates the biosynthesis of sordarial, a salicylic aldehyde structurally related to the phytotoxin pyriculol (PubMed:19277664, PubMed:28485098, PubMed:30908040). The most interesting aspect of this pathway is formation of an aromatic product from the highly reducing polyketide synthase srdA (PubMed:30908040). SrdA synthesizes a reduced polyketide chain from one molecule of acetyl-CoA and five molecules of malonyl-CoA (PubMed:30908040). The polyketide chain is then reductively released as an aldehyde (PubMed:30908040). The oxidoreductases srdC, srdD and srdE then oxidize one of the hydroxy groups to facilitate the intramolecular aldol condensation, followed by dehydration to yield a salicylic aldehyde (PubMed:30908040). This aldehyde can undergo facile reduction by endogenous reductases to yield the alcohol 1-hydroxy-2-hydroxymethyl-3-pent-1,3-dienylbenzene (PubMed:30908040). The flavin-dependent srdI counteract against the propensity of the aldehydes to be reduced under physiological conditions and is responsible for reoxidizing 1-hydroxy-2-hydroxymethyl-3-pent-1,3-dienylbenzene back to the salicylic aldehyde (PubMed:30908040). This salicylic aldehyde is then selectively epoxidized by the cupin-domain-containing oxidoreductase srdB to yield the epoxide, which can be hydrolyzed stereoselectively by the hydrolase srdG to give the final product sordarial (PubMed:30908040). {ECO:0000269|PubMed:19277664, ECO:0000269|PubMed:28485098, ECO:0000269|PubMed:30908040}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | NP_BIND 10..19; /note=NAD; /evidence=ECO:0000250|UniProtKB:Q92506; NP_BIND 38..39; /note=NAD; /evidence=ECO:0000250|UniProtKB:Q92506; NP_BIND 57..59; /note=NAD; /evidence=ECO:0000250|UniProtKB:Q92506; NP_BIND 150..154; /note=NAD; /evidence=ECO:0000250|UniProtKB:Q92506; NP_BIND 183..185; /note=NAD; /evidence=ECO:0000250|UniProtKB:Q92506 |
| Features | Active site (1); Chain (1); Glycosylation (1); Nucleotide binding (5); Transmembrane (1) |
| Keywords | Glycoprotein;Membrane;NAD;NADP;Oxidoreductase;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | INDUCTION: Expression is up-reglated during sexual development (PubMed:19277664). Expression is also up-reglated during confrontation with the arthropod fungivore Drosophila melanogaster (PubMed:28485098). {ECO:0000269|PubMed:19277664, ECO:0000269|PubMed:28485098}. |
| Subcellular Location | SUBCELLULAR LOCATION: Membrane {ECO:0000255}; Single-pass membrane protein {ECO:0000255}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 32,040 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |