| IED ID | IndEnz0005000822 |
| Enzyme Type ID | lipase000822 |
| Protein Name |
pFDCC methylesterase MES16 EC 3.1.1.- Methylesterase 16 AtMES16 Pheophorbidase AtPPD |
| Gene Name | MES16 PPD At4g16690 dl4370c FCAALL.12 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MGGEGGAEPVIHFVFVHGASHGAWCWYKLTTLLDAAGFKSTSVDLTGAGISLIDSNIVFDSDQYNRPLFSLLSDLPPHHKVILVGHSIGGGSVTEALCKFTDKISMAIYLAASMVQPGSIPSPHLSNIHVGEEDIWEYTYGEGTDKPPTGVLMKPEFIRHYYYSQSPLEDVTLSSKLLRPAPMRAFQDLDKLPPNPEAEKVPRVYIKTAKDNLFDSVRQDLLVENWPPSQLYVLEDSDHSAFFSVPTTLFAYLLRAVSFLQR |
| Enzyme Length | 262 |
| Uniprot Accession Number | O23512 |
| Absorption | |
| Active Site | ACT_SITE 87; /note=Acyl-ester intermediate; /evidence=ECO:0000269|PubMed:27109476; ACT_SITE 211; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:Q6RYA0; ACT_SITE 239; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:Q6RYA0 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=H2O + methyl (indol-3-yl)acetate = (indol-3-yl)acetate + H(+) + methanol; Xref=Rhea:RHEA:32919, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17790, ChEBI:CHEBI:30854, ChEBI:CHEBI:72782; Evidence={ECO:0000269|PubMed:18467465};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:32920; Evidence={ECO:0000269|PubMed:18467465}; CATALYTIC ACTIVITY: Reaction=H2O + methyl (-)-jasmonate = H(+) + jasmonate + methanol; Xref=Rhea:RHEA:55372, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:15929, ChEBI:CHEBI:17790, ChEBI:CHEBI:58431; Evidence={ECO:0000269|PubMed:18467465};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:55373; Evidence={ECO:0000269|PubMed:18467465}; CATALYTIC ACTIVITY: Reaction=H2O + primary fluorescent dioxobilin-type chlorophyll catabolite = H(+) + methanol + O13(4)-desmethyl pFDCC; Xref=Rhea:RHEA:67176, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17790, ChEBI:CHEBI:167885, ChEBI:CHEBI:167889; Evidence={ECO:0000269|PubMed:23723324};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:67177; Evidence={ECO:0000269|PubMed:23723324}; |
| DNA Binding | |
| EC Number | 3.1.1.- |
| Enzyme Function | FUNCTION: Involved in the chlorophyll breakdown by its action in fluorescent chlorophyll catabolites (FCCs) demethylation (PubMed:22147518, PubMed:23723324, PubMed:24302623). Demethylates the C13(2)-carboxymethyl group present at the isocyclic ring of chlorophyll (PubMed:22147518). Uses primary fluorescent dioxobilin-type chlorophyll catabolite (pFDCC) as substrate to produce O13(4)-desmethyl pFDCC (PubMed:23723324, PubMed:24302623). Also able to catalyze pheophorbides in vitro (PubMed:22147518). Methylesterase shown to have carboxylesterase activity, methyl indole-3-acetic acid (MeIAA) esterase activity and methyl jasmonate (MeJA) esterase activity in vitro (PubMed:18467465, PubMed:27109476). {ECO:0000269|PubMed:18467465, ECO:0000269|PubMed:22147518, ECO:0000269|PubMed:23723324, ECO:0000269|PubMed:24302623, ECO:0000269|PubMed:27109476}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Plant hormone biosynthesis. {ECO:0000269|PubMed:18467465}.; PATHWAY: Lipid metabolism; oxylipin biosynthesis. {ECO:0000269|PubMed:18467465}.; PATHWAY: Porphyrin-containing compound metabolism; chlorophyll degradation. {ECO:0000269|PubMed:22147518, ECO:0000269|PubMed:23723324}. |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (9); Chain (1); Helix (15); Mutagenesis (1) |
| Keywords | 3D-structure;Chlorophyll catabolism;Cytoplasm;Hydrolase;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:22147518}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 5HK8; |
| Mapped Pubmed ID | 12102506; 12535341; 16299181; 18643994; 18650403; 20736450; 23858430; 28627464; |
| Motif | |
| Gene Encoded By | |
| Mass | 29,014 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:32919; RHEA:32920; RHEA:55372; RHEA:55373; RHEA:67176; RHEA:67177 |
| Cross Reference Brenda |