| IED ID | IndEnz0005000844 |
| Enzyme Type ID | lipase000844 |
| Protein Name |
Monoacylglycerol lipase MGL EC 3.1.1.23 |
| Gene Name | MSMEG_0220 MSMEI_0213 |
| Organism | Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Mycobacteriaceae Mycolicibacterium Mycolicibacterium smegmatis (Mycobacterium smegmatis) Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) |
| Enzyme Sequence | MVSSTRSEHSFAGVGGVRIVYDVWTPDTDPRGVVVLAHGYAEHAGRYHHVAQRFGAAGLLVYALDHRGHGRSGGKRVHLRDLSEFVEDFRTLVGIAANDHPTLPRIVLGHSMGGGIVFAYGARYPGEYSAMVLSGPAVNAHDGVSPVLVAVAKVLGKLAPGIPVENLDADAVSRDPEVVAAYKADPMVHHGKLPAGIARALIGLGQSMPQRAAALTAPLLVVHGDKDRLIPVAGSRLLVDRVASEDVHLKVYPGLYHEVFNEPEQKLVLDDVTSWIVSHL |
| Enzyme Length | 280 |
| Uniprot Accession Number | A0QNZ7 |
| Absorption | |
| Active Site | ACT_SITE 111; /note=Nucleophile; /evidence=ECO:0000305|PubMed:20601476; ACT_SITE 227; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:O07427; ACT_SITE 257; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:O07427 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolyzes glycerol monoesters of long-chain fatty acids.; EC=3.1.1.23; Evidence={ECO:0000269|PubMed:20601476}; |
| DNA Binding | |
| EC Number | 3.1.1.23 |
| Enzyme Function | FUNCTION: Contributes to cell growth, probably by hydrolyzing exogenous lipids. Catalyzes the hydrolysis of monoacylglycerols (MAG) with fatty acid chains ranging from C14 to C18, with a maximum activity on monoolein. Is unable to hydrolyze long-chain diacylglycerol (DAG). {ECO:0000269|PubMed:20601476}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 8. Highly stable from pH 6.5 to 9.0, and still shows a residual activity of 50% after 1 hour of incubation at pH 4.0. {ECO:0000269|PubMed:20601476}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Mutagenesis (1) |
| Keywords | Cell wall;Fatty acid biosynthesis;Fatty acid metabolism;Hydrolase;Lipid biosynthesis;Lipid degradation;Lipid metabolism;Reference proteome;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, cell wall {ECO:0000269|PubMed:20601476}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 29,882 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |