| IED ID | IndEnz0005000972 |
| Enzyme Type ID | lipase000972 |
| Protein Name |
Vitellogenin-2 Vitellogenin II Yolk protein 2 |
| Gene Name | VG2-delta |
| Organism | Ceratitis capitata (Mediterranean fruit fly) (Tephritis capitata) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Diptera Brachycera Muscomorpha Eremoneura Cyclorrhapha Schizophora Acalyptratae Tephritoidea Tephritidae (fruit flies) Dacinae Ceratitidini Ceratitis Ceratitis Ceratitis capitata (Mediterranean fruit fly) (Tephritis capitata) |
| Enzyme Sequence | MNPLTIFCLVAVLLSAATAHRGSNAIRNNLQPSGXLSPRELEDMPAINEITFEKLQEMPAEEAADLVNKIYHLSQMSRNIEPSYAPSPNQIPAYTYTPTGQRVNFNLNQLVATAQQQPNFGKQEVTVFITGLPNKSSAMLTANQKLVQAYLQAYNGRVQVQGEQGDDSNQDTSSSEESSNRPNGQQPKPNGNLVVIDLGAVIRNFEDLVLLDINRVGAAIGNSLVQLTAQADVPQEVINIVAQGIAAHVAGAAARQYTRQTGNTLRRITAMDPSKIYARKPNTLVGLARGNADFVDAIHTSAYGLGTTTRAGDVDFYPNGPSVNMPGTDDIIEASLRATRYLAETVLPGNDRNFPAVAAESLQQYKNNNGNGRRAYMGIAADYDLEGDYILQVNAKSPFGKSAPAQKQNSYHGIHQGAGRPN |
| Enzyme Length | 422 |
| Uniprot Accession Number | P27587 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Vitellogenin is the major yolk protein of eggs where it is used as a food source during embryogenesis. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (2); Region (2); Signal peptide (1) |
| Keywords | Secreted;Signal |
| Interact With | |
| Induction | INDUCTION: By beta-ecdysone; in males. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000250 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 45,546 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |