| IED ID | IndEnz0005000998 |
| Enzyme Type ID | lipase000998 |
| Protein Name |
14-3-3-like protein 1 Partitioning defective protein 5 |
| Gene Name | par-5 ftt-1 M117.2 |
| Organism | Caenorhabditis elegans |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans |
| Enzyme Sequence | MSDTVEELVQRAKLAEQAERYDDMAAAMKKVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQLAKEYRVKVEQELNDICQDVLKLLDEFLIVKAGAAESKVFYLKMKGDYYRYLAEVASEDRAAVVEKSQKAYQEALDIAKDKMQPTHPIRLGLALNFSVFYYEILNTPEHACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDVGAEDQEQEGNQEAGN |
| Enzyme Length | 248 |
| Uniprot Accession Number | P41932 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Required to modulate lifespan, in concert with hcf-1, acting redundantly with 14-3-3-like protein ftt-2. {ECO:0000269|PubMed:21909281}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Sequence conflict (1) |
| Keywords | Cytoplasm;Nucleus;Reference proteome |
| Interact With | G5EC23; Q11184; Q10666; Q21921 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:16777605}. Nucleus {ECO:0000269|PubMed:16777605}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11784094; 12529635; 12588843; 14551910; 14675534; 14704431; 15066285; 15489339; 15791247; 16049479; 16580661; 16672054; 16824915; 16845399; 16860373; 17098225; 17704769; 17897480; 18182484; 19123269; 19597959; 19922876; 21110867; 21177967; 22560298; 22634595; 23604319; 23800452; 24957743; 25199833; 25487147; 26009280; 26921457; 26952210; 27506200; 28648843; 30353013; 31216475; 31283754; 9171285; |
| Motif | |
| Gene Encoded By | |
| Mass | 28,191 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |