| IED ID |
IndEnz0005001105 |
| Enzyme Type ID |
lipase001105 |
| Protein Name |
Bacteriocin SRCAM 37
|
| Gene Name |
|
| Organism |
Paenibacillus polymyxa (Bacillus polymyxa) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Paenibacillaceae
Paenibacillus
Paenibacillus polymyxa (Bacillus polymyxa)
|
| Enzyme Sequence |
FVYGNGVTSILVQAQFLVNGQRRFFYTPDK |
| Enzyme Length |
30 |
| Uniprot Accession Number |
P86395 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Bacteriocin with antibacterial activity against C.jejuni. {ECO:0000269|PubMed:15690798}. |
| Temperature Dependency |
BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Thermostable, activity is retained after incubation at 100 degrees Celsius for 15 minutes. {ECO:0000269|PubMed:15690798}; |
| PH Dependency |
BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Stable from pH 3.0-9.0, inactivated at pH 10.0. {ECO:0000269|PubMed:15690798}; |
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1) |
| Keywords |
Antibiotic;Antimicrobial;Bacteriocin;Direct protein sequencing;Secreted |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:15690798}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
3,466 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|