| IED ID | IndEnz0005001106 |
| Enzyme Type ID | lipase001106 |
| Protein Name |
Colipase A Fragment |
| Gene Name | CLPS1 |
| Organism | Equus caballus (Horse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Perissodactyla (odd-toed ungulates) Equidae (horses) Equus Equus Equus caballus (Horse) |
| Enzyme Sequence | LLLVALAVAYAVPDPRGVIINLEAGEICLNSAQCKSECCHQESSLSLARCAAKASENSECSAWTLYGVYYKCPCERGLTCQVDKTLVGSIMNTNFGICFDAARSEE |
| Enzyme Length | 106 |
| Uniprot Accession Number | P02704 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | BINDING 63; /note=Taurodeoxycholate; /evidence=ECO:0000305|PubMed:7075593 |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Colipase is a cofactor of pancreatic lipase. It allows the lipase to anchor itself to the lipid-water interface. Without colipase the enzyme is washed off by bile salts, which have an inhibitory effect on the lipase.; FUNCTION: Enterostatin has a biological activity as a satiety signal. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Binding site (1); Chain (1); Disulfide bond (5); Non-terminal residue (1); Propeptide (1); Sequence conflict (8); Signal peptide (1) |
| Keywords | Digestion;Direct protein sequencing;Disulfide bond;Lipid degradation;Lipid metabolism;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL <1..11; /evidence="ECO:0000269|PubMed:6691986, ECO:0000269|PubMed:7075593, ECO:0000269|PubMed:7417313" |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 11,388 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |