| IED ID | IndEnz0005001116 |
| Enzyme Type ID | lipase001116 |
| Protein Name |
Isoprenylcysteine alpha-carbonyl methylesterase ICME EC 3.1.1.n2 Isoprenylcysteine methylesterase Prenylcysteine methylesterase AtPCME |
| Gene Name | ICME PCME At5g15860 F14F8.240 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MHSPLQTQQPEQRCWPMTSTVSEIEEVLPDEDSDRTTLLNGEPLRRRVSGKSPVDEGPRRIFRQQSFGRDIGHAAAETYLITGLSFKLLRYLGVGYRWMTKLLALTCYAMLLMPGFLQVAYSYFFSKQVRRSIVYGDQPRNRLDLYLPSNNDGLKPVVVFVTGGAWIIGYKAWGSLLGMQLAERDIIVACLDYRNFPQGTISDMVTDASQGISFVCNNISAFGGDPNRIYLMGQSAGAHIAACALLEQATKELKGESISWTVSQIKAYFGLSGGYNLYKLVDHFHNRGLYRSIFLSIMEGEESFEKFSPEVRLKDPVVGKAASLLPPIILFHGSSDYSIPCDESKTFTDALQAVGAKAELVLYSGKTHTDLFLQDPLRGGKDELFDDIVSVIHAEDNDGLTKDSLAPPRKRLVPELLLKLAREISPF |
| Enzyme Length | 427 |
| Uniprot Accession Number | Q94AS5 |
| Absorption | |
| Active Site | ACT_SITE 235; /evidence=ECO:0000305; ACT_SITE 336; /evidence=ECO:0000305; ACT_SITE 368; /evidence=ECO:0000305 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=[protein]-C-terminal S-[(2E,6E)-farnesyl]-L-cysteine methyl ester + H2O = [protein]-C-terminal S-[(2E,6E)-farnesyl]-L-cysteine + H(+) + methanol; Xref=Rhea:RHEA:48520, Rhea:RHEA-COMP:12125, Rhea:RHEA-COMP:12126, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17790, ChEBI:CHEBI:90510, ChEBI:CHEBI:90511; EC=3.1.1.n2; Evidence={ECO:0000269|PubMed:16870359, ECO:0000269|PubMed:18957507}; |
| DNA Binding | |
| EC Number | 3.1.1.n2 |
| Enzyme Function | FUNCTION: Catalyzes the demethylation of isoprenylcysteine methylesters. In vitro, is specific for N-acetyl-S-farnesyl-L-cysteine methyl ester (AFCme) and has low activity toward N-acetyl-S-geranyl-L-cysteine methyl ester (AGCme). Acts as a positive regulator of ABA signaling. May be involved in the demethylation and inactivation of isoprenylated negative regulators of abscisic acid (ABA) signaling. Carboxyl methylation is a reversible and potentially regulated step in the post-translational modification of prenylated proteins. {ECO:0000269|PubMed:16870359, ECO:0000269|PubMed:18957507, ECO:0000269|PubMed:20868530}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Alternative sequence (2); Chain (1); Erroneous gene model prediction (1); Region (3); Transmembrane (2) |
| Keywords | Alternative splicing;Endoplasmic reticulum;Golgi apparatus;Hydrolase;Membrane;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | INDUCTION: By ABA, osmotic stress and salt and heat treatments. {ECO:0000269|PubMed:18957507, ECO:0000269|PubMed:20868530}. |
| Subcellular Location | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000269|PubMed:20868530}. Golgi apparatus membrane {ECO:0000269|PubMed:20868530}; Multi-pass membrane protein {ECO:0000269|PubMed:20868530}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 14738307; 16698895; 16895613; 18650403; |
| Motif | |
| Gene Encoded By | |
| Mass | 47,582 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:48520 |
| Cross Reference Brenda |