| IED ID | IndEnz0005001170 |
| Enzyme Type ID | lipase001170 |
| Protein Name |
Carboxylesterase 1 AeCXE1 EC 3.1.1.1 |
| Gene Name | CXE1 |
| Organism | Actinidia eriantha (Velvet vine) (Actinidia fulvicoma var. lanata) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids Ericales Actinidiaceae Actinidia Actinidia eriantha (Velvet vine) (Actinidia fulvicoma var. lanata) |
| Enzyme Sequence | MSNDHLETTGSSDPNTNLLKYLPIVLNPDRTITRPIQIPSTAASPDPTSSSPVLTKDLALNPLHNTFVRLFLPRHALYNSAKLPLVVYFHGGGFILFSAASTIFHDFCCEMAVHAGVVIASVDYRLAPEHRLPAAYDDAMEALQWIKDSRDEWLTNFADFSNCFIMGESAGGNIAYHAGLRAAAVADELLPLKIKGLVLDEPGFGGSKRTGSELRLANDSRLPTFVLDLIWELSLPMGADRDHEYCNPTAESEPLYSFDKIRSLGWRVMVVGCHGDPMIDRQMELAERLEKKGVDVVAQFDVGGYHAVKLEDPEKAKQFFVILKKFVVDSCTTKL |
| Enzyme Length | 335 |
| Uniprot Accession Number | Q0ZPV7 |
| Absorption | |
| Active Site | ACT_SITE 169; /evidence=ECO:0000305; ACT_SITE 276; /evidence=ECO:0000305; ACT_SITE 306; /evidence=ECO:0000305 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=a carboxylic ester + H2O = a carboxylate + an alcohol + H(+); Xref=Rhea:RHEA:21164, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:29067, ChEBI:CHEBI:30879, ChEBI:CHEBI:33308; EC=3.1.1.1; |
| DNA Binding | |
| EC Number | 3.1.1.1 |
| Enzyme Function | FUNCTION: Carboxylesterase acting on esters with varying acyl chain length. {ECO:0000269|PubMed:17256879}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (9); Chain (1); Helix (12); Motif (1); Region (2); Turn (6) |
| Keywords | 3D-structure;Hydrolase;Serine esterase |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 2O7R; 2O7V; |
| Mapped Pubmed ID | - |
| Motif | MOTIF 90..92; /note=Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole; /evidence=ECO:0000250|UniProtKB:Q5NUF3 |
| Gene Encoded By | |
| Mass | 37,052 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=33.3 uM for 4-methylumbelliferyl acetate {ECO:0000269|PubMed:17256879}; KM=16.7 uM for 4-methylumbelliferyl butyrate {ECO:0000269|PubMed:17256879}; KM=19.1 uM for 4-methylumbelliferyl heptanoate {ECO:0000269|PubMed:17256879}; KM=6.34 uM for 4-methylumbelliferyl octanoate {ECO:0000269|PubMed:17256879}; KM=0.117 uM for 4-methylumbelliferyl laureate {ECO:0000269|PubMed:17256879}; KM=0.024 uM for 4-methylumbelliferyl palmitate {ECO:0000269|PubMed:17256879}; |
| Metal Binding | |
| Rhea ID | RHEA:21164 |
| Cross Reference Brenda | 3.1.1.1; |