| IED ID | IndEnz0005001182 |
| Enzyme Type ID | lipase001182 |
| Protein Name |
Apovitellenin-1 Apovitellenin I |
| Gene Name | |
| Organism | Anas platyrhynchos (Mallard) (Anas boschas) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Anseriformes (ducks geese and swans) Anatidae (waterfowl) Anatinae Anas (ducks) Anas platyrhynchos (Mallard) (Anas boschas) |
| Enzyme Sequence | KSIFERDRRDWLVIPDAIAAYIYETVNKMSPRVGQFLADAAQTPVVVGTRTFLIRETSKLTLLAEQLMEKIKNLWYTKVLGY |
| Enzyme Length | 82 |
| Uniprot Accession Number | P02658 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Protein component of the very low density lipoprotein (VLDL) of egg-laying females. Potent lipoprotein lipase inhibitor, preventing the loss of triglycerides from VLDL on their way from the liver to the growing oocytes. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Direct protein sequencing;Storage protein;VLDL |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,492 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |