| IED ID | IndEnz0005001183 |
| Enzyme Type ID | lipase001183 |
| Protein Name |
Apolipoprotein A-V Apo-AV ApoA-V Apolipoprotein A5 |
| Gene Name | APOA5 |
| Organism | Neomonachus schauinslandi (Hawaiian monk seal) (Monachus schauinslandi) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Carnivora Caniformia Phocidae (true seals) Neomonachus Neomonachus schauinslandi (Hawaiian monk seal) (Monachus schauinslandi) |
| Enzyme Sequence | MVAVLTWALALLSAFATVQTQKGFWDYFSQSSGDKSKVARVQQQKLTWEPTSLKDSLEQDLSNMDKFLEKLGPLSGQGREPPGLPHDPEGMRQQLQEELAEVRARLEPYMAEAHQQVGWNLEGLRRQLKPYTVELMEQVARRVQELQEQLRVVGEGTKAQLLGGVDEARGLLQELQTRVVQHTGRVRELFHPYAQRLVTGIGRHVQELHRSVAPHAAASSARLSRCVQTLSRKLTLKAEALHARIQQNLGQLREELSAFASAGAGGAEEGANPDAQMLSQEVRQRLQAFRHDTFLQIADFTRAIDQETEEVQLQLAPPPPGHSAFAPEFLQADSSEARSKLQARLEDLWEDINDSLHDRGLSHLEEP |
| Enzyme Length | 367 |
| Uniprot Accession Number | A0A2Y9HKE5 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Minor apolipoprotein mainly associated with HDL and to a lesser extent with VLDL. May also be associated with chylomicrons (By similarity). Important determinant of plasma triglyceride (TG) levels by both being a potent stimulator of apo-CII lipoprotein lipase (LPL) TG hydrolysis and an inhibitor of the hepatic VLDL-TG production rate (without affecting the VLDL-apoB production rate) (By similarity). Activates poorly lecithin:cholesterol acyltransferase (LCAT) and does not enhance efflux of cholesterol from macrophages (By similarity). Binds heparin (By similarity). {ECO:0000250|UniProtKB:Q6Q788, ECO:0000250|UniProtKB:Q8C7G5}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Modified residue (1); Region (1); Signal peptide (1) |
| Keywords | Chylomicron;Coiled coil;Endosome;Golgi apparatus;HDL;Lipid transport;Phosphoprotein;Reference proteome;Secreted;Signal;Transport;VLDL |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:Q6Q788}. Early endosome {ECO:0000250|UniProtKB:Q6Q788}. Late endosome {ECO:0000250|UniProtKB:Q6Q788}. Golgi apparatus, trans-Golgi network {ECO:0000250|UniProtKB:Q6Q788}. Note=In the presence of SORL1, internalized to early endosomes, sorted in a retrograde fashion to late endosomes, from which a portion is sent to lysosomes and degradation, another portion is sorted to the trans-Golgi network. {ECO:0000250|UniProtKB:Q6Q788}. |
| Modified Residue | MOD_RES 56; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q6Q788 |
| Post Translational Modification | PTM: Phosphorylated by FAM20C in the extracellular medium. {ECO:0000250|UniProtKB:Q6Q788}. |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 41,156 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |