| IED ID | IndEnz0005001222 |
| Enzyme Type ID | lipase001222 |
| Protein Name |
Apolipoprotein A-II Apo-AII ApoA-II Apolipoprotein A2 Cleaved into: Truncated apolipoprotein A-II |
| Gene Name | APOA2 |
| Organism | Macaca mulatta (Rhesus macaque) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Cercopithecoidea Cercopithecidae (Old World monkeys) Cercopithecinae Macaca (macaques) Macaca mulatta (Rhesus macaque) |
| Enzyme Sequence | QAEEPSVESLVSQYFQTVTDYGKDLMEKVKSPELQAQAKAYFEKSKEQLTPLVKKAGTDLVNFLSYFVELRTQPATQ |
| Enzyme Length | 77 |
| Uniprot Accession Number | P02653 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Apo A-II makes up about 20% of the protein of the HDL (high density lipoprotein) phospholipid-rich fraction in plasma. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Modified residue (4) |
| Keywords | Direct protein sequencing;HDL;Lipid transport;Oxidation;Phosphoprotein;Pyrrolidone carboxylic acid;Reference proteome;Secreted;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P02652}. |
| Modified Residue | MOD_RES 1; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000269|PubMed:814923; MOD_RES 26; /note=Methionine sulfoxide; /evidence=ECO:0000250|UniProtKB:P02652; MOD_RES 31; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P02652; MOD_RES 45; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P02652 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,747 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |