| IED ID | IndEnz0005001236 |
| Enzyme Type ID | lipase001236 |
| Protein Name |
Cardiolipin-specific deacylase 1, mitochondrial EC 3.5.1.- |
| Gene Name | CLD1 YGR110W G6140 |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (Baker's yeast) Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Enzyme Sequence | MFKSTLNSIIRRPLKGFQLLRGADSSNTRPQSPRASARDVTEKQILRTPSAPTAIPLREIIYRVPSLFPRPLEDSVKDFRDFIKNEDAFQTELLKTLPFYPTPSESKTARLIRTVVDDEGNYINEFCIRPRKTSVPEADLKHLVFIHGYGAGLGFFIKNFEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPRDNIHSVQDWFHERIHTWFSKRNLLNRPEKNIVMAHSLGSYLMALYLQKYKESPSFKKLILCSPAGVSYRDFNNTASEVEKWKPPPWWYVKLWDRNISPFTLVRNFRQLGSKITSGWSYRRFKHILNGDPEQSKRFEALHRYAYAIFNKRGSGEYLLSFALKCGGEPRLSLEQQLFDGKKSDILKNSNCDWLWLYGDDDWMDVNGGLRVSRFLKEKLKQKSNVIIVPHSGHHLYLDNYKFFNNILTKEMQKI |
| Enzyme Length | 445 |
| Uniprot Accession Number | P53264 |
| Absorption | |
| Active Site | ACT_SITE 230; /note=Nucleophile; /evidence=ECO:0000269|PubMed:23637464; ACT_SITE 392; /note=Charge relay system; /evidence=ECO:0000269|PubMed:23637464; ACT_SITE 424; /note=Charge relay system; /evidence=ECO:0000269|PubMed:23637464 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=a cardiolipin + H2O = 1'-[1,2-diacyl-sn-glycero-3-phospho],3'-[1-acyl-sn-glycero-3-phospho]-glycerol + a fatty acid + H(+); Xref=Rhea:RHEA:32935, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:28868, ChEBI:CHEBI:62237, ChEBI:CHEBI:64743; Evidence={ECO:0000269|PubMed:19244244, ECO:0000269|PubMed:24318983, ECO:0000269|PubMed:27982579};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:32936; Evidence={ECO:0000305|PubMed:19244244, ECO:0000305|PubMed:24318983, ECO:0000305|PubMed:27982579}; |
| DNA Binding | |
| EC Number | 3.5.1.- |
| Enzyme Function | FUNCTION: Mitochondrial cardiolipin-specific phospholipase which deacylates de novo synthesized cardiolipin (CL). Part of the remodeling process of cardiolipin, which involves deacylation-reacylation of premature cardiolipin. Has a strong substrate preference for palmitic acid residues and generates monolysocardiolipin (MLCL) for TAZ1-dependent reacylation with unsaturated fatty acids (PubMed:19244244, PubMed:23637464). The hydrolytic selectivity of the enzyme toward C16-CL substrates contributes to the preservation of C18:1-containing CL species (PubMed:27982579). Has high specificity towards peroxidized cardiolipids CL(OX). Required to mitigate oxidative stress by removing CL(OX) (PubMed:29935382). {ECO:0000269|PubMed:19244244, ECO:0000269|PubMed:23637464, ECO:0000269|PubMed:27982579, ECO:0000269|PubMed:29935382}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Compositional bias (1); Domain (1); Motif (2); Mutagenesis (5); Region (1); Transit peptide (1) |
| Keywords | Hydrolase;Membrane;Mitochondrion;Mitochondrion inner membrane;Reference proteome;Transferase;Transit peptide |
| Interact With | |
| Induction | INDUCTION: Expressed in aerobic conditions and under genotoxic stress (PubMed:10601195, PubMed:15878181). Expression is increased during respiratory growth and regulated by the heme activator protein transcriptional activation complex (PubMed:24318983). {ECO:0000269|PubMed:10601195, ECO:0000269|PubMed:15878181, ECO:0000269|PubMed:24318983}. |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion {ECO:0000269|PubMed:19244244}. Mitochondrion inner membrane {ECO:0000269|PubMed:23637464}; Peripheral membrane protein {ECO:0000269|PubMed:23637464}; Matrix side {ECO:0000269|PubMed:23637464}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11283351; 14690591; 17630978; 18202368; 19536198; 20818735; 21912624; 22345606; 24007978; 24184646; 24190879; 24220496; 24285538; 24520995; 24678285; 24926745; 25432572; 26819558; 27402848; 27502688; |
| Motif | MOTIF 228..232; /note=GXSXG lipase motif; /evidence=ECO:0000305|PubMed:19244244; MOTIF 424..429; /note=HXXXXD acyl transferase motif; /evidence=ECO:0000305|PubMed:19244244 |
| Gene Encoded By | |
| Mass | 52,045 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:32935; RHEA:32936 |
| Cross Reference Brenda |