| IED ID | IndEnz0005001241 |
| Enzyme Type ID | lipase001241 |
| Protein Name |
Chlorophyllase-1, chloroplastic EC 3.1.1.14 Chlorophyll-chlorophyllido hydrolase 1 Chlase 1 |
| Gene Name | CHLASE1 |
| Organism | Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Sapindales Rutaceae Aurantioideae Citrus Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis) |
| Enzyme Sequence | MAAMVDAKPAASVQGTPLLATATLPVFTRGIYSTKRITLETSSPSSPPPPKPLIIVTPAGKGTFNVILFLHGTSLSNKSYSKIFDHIASHGFIVVAPQLYTSIPPPSATNELNSAAEVAEWLPQGLQQNLPENTEANVSLVAVMGHSRGGQTAFALSLRYGFGAVIGLDPVAGTSKTTGLDPSILSFDSFDFSIPVTVIGTGLGGVARCITACAPEGANHEEFFNRCKNSSRAHFVATDYGHMDILDDNPSDVKSWALSKYFCKNGNESRDPMRRCVSGIVVAFLKDFFYGDAEDFRQILKDPSFAPIKLDSVEYIDASSMLTTTHVKV |
| Enzyme Length | 329 |
| Uniprot Accession Number | Q9MV14 |
| Absorption | |
| Active Site | ACT_SITE 147; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:Q9LE89; ACT_SITE 169; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:Q9LE89; ACT_SITE 242; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:Q9LE89 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=a chlorophyll + H2O = a chlorophyllide + H(+) + phytol; Xref=Rhea:RHEA:19605, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17327, ChEBI:CHEBI:139291, ChEBI:CHEBI:139292; EC=3.1.1.14; |
| DNA Binding | |
| EC Number | 3.1.1.14 |
| Enzyme Function | FUNCTION: Catalyzes the hydrolysis of ester bond in chlorophyll to yield chlorophyllide and phytol. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 45 degrees Celsius. Active from 30 to 60 degrees Celsius.; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 7.5. Active from pH 5.0 to 9.0.; |
| Pathway | PATHWAY: Porphyrin-containing compound metabolism; chlorophyll degradation. |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Motif (1); Transit peptide (1) |
| Keywords | Chlorophyll catabolism;Chloroplast;Direct protein sequencing;Hydrolase;Plastid;Transit peptide |
| Interact With | |
| Induction | INDUCTION: Low constitutive expression during fruit development and no marked increase towards the later stages of maturation. Strongly induced after 24 hours of exogenous ethylene treatment and increased further up to 7 days. Gibberellin-A3 (GA3) and the cytokinin N6-benzyladenine (BA) inhibit this induction by ethylene. {ECO:0000269|PubMed:11607429}. |
| Subcellular Location | SUBCELLULAR LOCATION: Plastid, chloroplast {ECO:0000269|Ref.3}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 145..149; /note=GXSXG; /evidence=ECO:0000250|UniProtKB:Q948R1 |
| Gene Encoded By | |
| Mass | 35,209 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=1.76 uM for chlorophyll; |
| Metal Binding | |
| Rhea ID | RHEA:19605 |
| Cross Reference Brenda | 3.1.1.14; |