| IED ID | IndEnz0005001243 |
| Enzyme Type ID | lipase001243 |
| Protein Name |
Chlorophyllase-2 AtCLH2 EC 3.1.1.14 Chlorophyll-chlorophyllido hydrolase 2 Chlase 2 |
| Gene Name | CLH2 At5g43860 MQD19.22 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MSSSSSRNAFEDGKYKSNLLTLDSSSRCCKITPSSRASPSPPKQLLVATPVEEGDYPVVMLLHGYLLYNSFYSQLMLHVSSHGFILIAPQLYSIAGPDTMDEIKSTAEIMDWLSVGLNHFLPAQVTPNLSKFALSGHSRGGKTAFAVALKKFGYSSNLKISTLIGIDPVDGTGKGKQTPPPVLAYLPNSFDLDKTPILVIGSGLGETARNPLFPPCAPPGVNHREFFRECQGPAWHFVAKDYGHLDMLDDDTKGIRGKSSYCLCKNGEERRPMRRFVGGLVVSFLKAYLEGDDRELVKIKDGCHEDVPVEIQEFEVIM |
| Enzyme Length | 318 |
| Uniprot Accession Number | Q9M7I7 |
| Absorption | |
| Active Site | ACT_SITE 138; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:Q9LE89; ACT_SITE 167; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:Q9LE89; ACT_SITE 244; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:Q9LE89 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=a chlorophyll + H2O = a chlorophyllide + H(+) + phytol; Xref=Rhea:RHEA:19605, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17327, ChEBI:CHEBI:139291, ChEBI:CHEBI:139292; EC=3.1.1.14; Evidence={ECO:0000269|PubMed:10611389};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:19606; Evidence={ECO:0000269|PubMed:10611389}; CATALYTIC ACTIVITY: Reaction=chlorophyll a + H2O = chlorophyllide a + H(+) + phytol; Xref=Rhea:RHEA:38011, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:17327, ChEBI:CHEBI:58416, ChEBI:CHEBI:83348; Evidence={ECO:0000269|PubMed:10611389};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:38012; Evidence={ECO:0000269|PubMed:10611389}; |
| DNA Binding | |
| EC Number | 3.1.1.14 |
| Enzyme Function | FUNCTION: Catalyzes the hydrolysis of ester bond in chlorophyll to yield chlorophyllide and phytol (PubMed:10611389). Does not seem to be required for chlorophyll degradation during senescence (PubMed:17996203, PubMed:18349515, PubMed:31779896). {ECO:0000269|PubMed:10611389, ECO:0000269|PubMed:17996203, ECO:0000269|PubMed:18349515, ECO:0000269|PubMed:31779896}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Porphyrin-containing compound metabolism; chlorophyll degradation. {ECO:0000305}. |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Motif (1); Sequence conflict (2) |
| Keywords | Chlorophyll catabolism;Cytoplasm;Hydrolase;Reference proteome |
| Interact With | |
| Induction | INDUCTION: Constitutively expressed at low level (PubMed:11950974). Not induced by methyl jasmonate treatment (PubMed:11950974). Induced by transition from dark to white light (PubMed:21896889). {ECO:0000269|PubMed:11950974, ECO:0000269|PubMed:21896889}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm, cytosol {ECO:0000269|PubMed:17996203, ECO:0000269|PubMed:31779896}. Note=Associates with the tonoplast and endoplasmic reticulum. {ECO:0000269|PubMed:31779896}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12777052; 14576160; 15598807; 17409091; 17513504; 20348210; 25041167; 25059706; 27092150; |
| Motif | MOTIF 136..140; /note=GXSXG; /evidence=ECO:0000250|UniProtKB:Q948R1 |
| Gene Encoded By | |
| Mass | 34,904 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:19605; RHEA:19606; RHEA:38011; RHEA:38012 |
| Cross Reference Brenda | 3.1.1.14; |