| IED ID | IndEnz0005001245 |
| Enzyme Type ID | lipase001245 |
| Protein Name |
Colipase Procolipase II |
| Gene Name | CLPS |
| Organism | Sus scrofa (Pig) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Suina Suidae (pigs) Sus Sus scrofa (Pig) |
| Enzyme Sequence | MEKVLALLLVTLTVAYAVPDPRGIIINLDEGELCLNSAQCKSNCCQHDTILSLSRCALKARENSECSAFTLYGVYYKCPCERGLTCEGDKSLVGSITNTNFGICHDVGRSSD |
| Enzyme Length | 112 |
| Uniprot Accession Number | P02703 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Colipase is a cofactor of pancreatic lipase. It allows the lipase to anchor itself to the lipid-water interface. Without colipase the enzyme is washed off by bile salts, which have an inhibitory effect on the lipase. {ECO:0000250|UniProtKB:P04118}.; FUNCTION: Enterostatin has a biological activity as a satiety signal. {ECO:0000250|UniProtKB:P04118}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (8); Chain (1); Disulfide bond (5); Helix (2); Propeptide (1); Sequence conflict (5); Signal peptide (1) |
| Keywords | 3D-structure;Digestion;Direct protein sequencing;Disulfide bond;Lipid degradation;Lipid metabolism;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..17; /evidence=ECO:0000269|PubMed:6691986 |
| Structure 3D | X-ray crystallography (4); NMR spectroscopy (2) |
| Cross Reference PDB | 1ETH; 1LPA; 1LPB; 1N8S; 1PCN; 1PCO; |
| Mapped Pubmed ID | 7893686; |
| Motif | |
| Gene Encoded By | |
| Mass | 12,140 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |