Detail Information for IndEnz0005001338
IED ID IndEnz0005001338
Enzyme Type ID lipase001338
Protein Name Zinc finger protein GLIS2 homolog
Protein sugarbabe
Gene Name sug CG3850
Organism Drosophila melanogaster (Fruit fly)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Diptera Brachycera Muscomorpha Eremoneura Cyclorrhapha Schizophora Acalyptratae Ephydroidea Drosophilidae (pomace flies) Drosophilinae Drosophilini Drosophila (fruit flies) Sophophora melanogaster group melanogaster subgroup Drosophila melanogaster (Fruit fly)
Enzyme Sequence MDIIQKSIFNSGPHSRGIYEPPLGYFTPYNTPPYIAAYSDSGSWLADHHQHHQQQHQQHQQQMQHIRFPTPPITPPRPIAGYGYRQRTQSVIMKARGQQDELCRSPVEFPDDSKSCSSSSECGTASDFVCNWTDCDRVFDTLDALAQHVTQRHAIASLTDGLYYCRWRGCQRSERGFNARYKMLVHTRTHTKEKPHRCHLCEKSFSRAENLKIHIRSHSGEKPYKCSFEGCQKAYSNSSDRFKHTRTHSMEKPYMCKVAGCQKRYTDPSSLRKHVKTFKHSIHLIASQPLTLPSVPCLLEASSESAFTCLPAASSVESTSSSSSARYYDDSNNEPSDYSLKPKQDAEFSPSYWLGDRQHSYLHSEDFFVKMDVESPLDLRIHRI
Enzyme Length 384
Uniprot Accession Number Q7K0S9
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Transcription factor which represses a set of lipase genes involved in fat catabolism. {ECO:0000269|PubMed:12426388}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Compositional bias (1); Region (1); Zinc finger (5)
Keywords DNA-binding;Developmental protein;Metal-binding;Nucleus;Reference proteome;Repeat;Repressor;Transcription;Transcription regulation;Zinc;Zinc-finger
Interact With
Induction INDUCTION: Strongly and rapidly induced in larvae by maltose, trehalose, glucose, fructose or saccharose, but not by lactose or galactose. {ECO:0000269|PubMed:12426388}.
Subcellular Location SUBCELLULAR LOCATION: Nucleus {ECO:0000250}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID 14605208; 14749722; 15207846; 15575970; 16054033; 16814731; 17578907; 19018044; 19079254; 19154620; 19573582; 19740772; 20220848; 20371351; 20617173; 20925960; 20980240; 21074052; 21159815; 21278706; 21641546; 21945372; 22430022; 22479193; 22796493; 23071443; 24755363; 24810915; 24865556; 24961800; 25193493; 25312911; 25568052; 25616197; 25748510; 25779349; 26162375; 26173873; 26231660; 26440885; 26550828; 27783936; 27923532; 29084242; 29203701; 29278834; 29440697; 30143789; 30247122; 30995488; 31014246; 31061470; 31722958; 31794428; 31799578; 31851941; 32978973; 33064591; 33369866; 33723074; 34108216; 34634038;
Motif
Gene Encoded By
Mass 44,035
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda