| IED ID | IndEnz0005001354 |
| Enzyme Type ID | lipase001354 |
| Protein Name |
Protein ABHD11 EC 3.-.-.- Alpha/beta hydrolase domain-containing protein 11 Abhydrolase domain-containing protein 11 Williams-Beuren syndrome chromosomal region 21 protein homolog |
| Gene Name | Abhd11 Wbscr21 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MLRWARAWRVPRGVLGASSPRRLAVPVTFCSSRSSGQENADLRPLPLSYNLLDGDATLPAIVFLHGLFGSKTNFNSLAKAMVQRTGRRVLTVDARNHGDSPHSPDASYEAMSQDLQGLLPQLGLVPCVLVGHSMGGKTAMLLALQRPDVVERLVVVDISPVGTTPGSHIGAFIAAMKAVEIPEKVPHSQARKLADKQLSSVVKEAGIRQFLLTNLVEVGGRFSWRLNLDTLAQHLDKIMTFPQQREPYSGPTLFLLGGNSTYVQPSHHSEIRRLFPQAQIQTVPNAGHWVHSDKPQDFMDAVTSFLA |
| Enzyme Length | 307 |
| Uniprot Accession Number | Q8K4F5 |
| Absorption | |
| Active Site | ACT_SITE 133; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 229; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 288; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.-.-.- |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Modified residue (2) |
| Keywords | Hydrolase;Reference proteome |
| Interact With | |
| Induction | INDUCTION: Up-regulated by rosiglitazone and down-regulated by high fat feeding. {ECO:0000269|PubMed:17215164}. |
| Subcellular Location | |
| Modified Residue | MOD_RES 79; /note=N6-succinyllysine; /evidence=ECO:0007744|PubMed:23806337; MOD_RES 196; /note=N6-succinyllysine; /evidence=ECO:0007744|PubMed:23806337 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11217851; 11779826; 12466851; 14610273; 18614015; 21267068; 25619660; 32579589; |
| Motif | |
| Gene Encoded By | |
| Mass | 33,561 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |