| IED ID | IndEnz0005001387 |
| Enzyme Type ID | lipase001387 |
| Protein Name |
Apolipoprotein C-I Apo-CI ApoC-I Apolipoprotein C1 Cleaved into: Truncated apolipoprotein C-I |
| Gene Name | APOC1 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS |
| Enzyme Length | 83 |
| Uniprot Accession Number | P02654 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein. {ECO:0000269|PubMed:17339654, ECO:0000303|PubMed:25160599}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (1); Chain (2); Helix (1); Natural variant (2); Signal peptide (1) |
| Keywords | 3D-structure;Direct protein sequencing;Lipid transport;Reference proteome;Secreted;Signal;Transport;VLDL |
| Interact With | Q13085-4; Q96CM8; P56378-2; Q92843; Q9UHD4; Q8N5I4; Q6VB84; Q96QA5; Q99525; A8MV81; Q6P1Q0; Q8WWC4; Q5XKP0; O95563; Q9Y6C9; Q96E29; Q9UMS0; Q96JH8; Q8WXG1; Q14D33; O00241-2; Q9NZD8; Q17RD7; Q53QW1; Q6ZUI0 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000303|PubMed:2835369}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..26; /evidence="ECO:0000269|PubMed:166984, ECO:0000269|PubMed:4369340" |
| Structure 3D | X-ray crystallography (4); NMR spectroscopy (4) |
| Cross Reference PDB | 1ALE; 1ALF; 1IOJ; 1OPP; 6DVU; 6DXR; 6DZ6; 6NF3; |
| Mapped Pubmed ID | 10191299; 10224102; 10852956; 11353333; 11702052; 11714102; 11825674; 12032151; 12044170; 12113906; 12220441; 12429068; 12658354; 12678662; 12700342; 12700345; 12705839; 12736801; 12805445; 12860251; 12962909; 14523051; 14705977; 14746139; 15077570; 15174051; 15265030; 15339254; 15364690; 15576844; 15591219; 15767578; 15769335; 15777558; 15793777; 15840864; 15900219; 16159884; 16459141; 16544732; 16608402; 16631424; 16763159; 16935938; 17254710; 17310220; 17341095; 17667986; 17761674; 17936795; 17998437; 18037960; 18049452; 18160739; 18193043; 18193044; 18262040; 18644789; 18667498; 18802019; 18835943; 18976728; 18984910; 19014618; 19060906; 19062221; 19197348; 19252179; 19336575; 19368908; 19417222; 19494537; 19567438; 19761869; 19785722; 19808960; 19812053; 19913121; 19936222; 20145290; 20308432; 20331378; 20339536; 20430392; 20498921; 20571754; 20580041; 20628086; 20691829; 20714348; 20864672; 20880607; 20972250; 21187063; 21533863; 21776394; 21900206; 21943158; 22022282; 22264166; 22404376; 22461740; 22474067; 22710912; 22995522; 23300094; 23555584; 23620136; 23670531; 24121499; 24498013; 24574346; 24582705; 26129832; 26576771; 26639962; 26657933; 27040450; 27052600; 27179730; 27805002; 27806189; 27976371; 28065845; 28486432; 29636060; 30130702; 30559175; 30684189; 31006040; 31211449; 31779116; 32619263; 32826950; 32961112; 33305507; 33591959; 8294473; 9633939; |
| Motif | |
| Gene Encoded By | |
| Mass | 9,332 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |