| IED ID | IndEnz0005001394 |
| Enzyme Type ID | lipase001394 |
| Protein Name |
Envelope phospholipase F13 EC 3.1.1.- 37 kDa protein Palmitoylated EV membrane protein p37K |
| Gene Name | VACWR052 F13L |
| Organism | Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Chitovirales Poxviridae Chordopoxvirinae Orthopoxvirus Vaccinia virus Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) |
| Enzyme Sequence | MWPFASVPAGAKCRLVETLPENMDFRSDHLTTFECFNEIITLAKKYIYIASFCCNPLSTTRGALIFDKLKEASEKGIKIIVLLDERGKRNLGELQSHCPDINFITVNIDKKNNVGLLLGCFWVSDDERCYVGNASFTGGSIHTIKTLGVYSDYPPLATDLRRRFDTFKAFNSAKNSWLNLCSAACCLPVSTAYHIKNPIGGVFFTDSPEHLLGYSRDLDTDVVIDKLKSAKTSIDIEHLAIVPTTRVDGNSYYWPDIYNSIIEAAINRGVKIRLLVGNWDKNDVYSMATARSLDALCVQNDLSVKVFTIQNNTKLLIVDDEYVHITSANFDGTHYQNHGFVSFNSIDKQLVSEAKKIFERDWVSSHSKSLKI |
| Enzyme Length | 372 |
| Uniprot Accession Number | P04021 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.1.- |
| Enzyme Function | FUNCTION: Major envelope protein that plays a role in the biogenesis of the viral double membrane and in egress of virus from the host cell (PubMed:8999886, PubMed:17475658, PubMed:27466413). Produces the wrapped form of virus that is required for cell-to-cell spread (PubMed:27466413, PubMed:29540596). Acts as a lipase with broad specificity including phospholipase C, phospholipase A, and triacylglycerol lipase activities (PubMed:9405398). {ECO:0000269|PubMed:17475658, ECO:0000269|PubMed:27466413, ECO:0000269|PubMed:29540596, ECO:0000269|PubMed:8999886, ECO:0000269|PubMed:9405398}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Lipidation (2); Motif (1) |
| Keywords | Host Golgi apparatus;Host endoplasmic reticulum;Host membrane;Host-virus interaction;Hydrolase;Late protein;Lipoprotein;Membrane;Palmitate;Reference proteome;Viral budding;Viral budding via the host ESCRT complexes;Viral envelope protein;Viral release from host cell;Virion |
| Interact With | P68617 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Virion membrane {ECO:0000269|PubMed:12706074}; Lipid-anchor {ECO:0000269|PubMed:12706074}. Host Golgi apparatus, host trans-Golgi network {ECO:0000269|PubMed:27466413, ECO:0000269|PubMed:29540596}. Host endoplasmic reticulum membrane {ECO:0000269|PubMed:12706074}; Lipid-anchor {ECO:0000269|PubMed:12706074}; Cytoplasmic side {ECO:0000269|PubMed:12706074}. Note=Component of the inner side of the enveloped virion (EV) membrane. F13 is associated post-translationally with membranes. |
| Modified Residue | |
| Post Translational Modification | PTM: Palmitoylated. Attachment of the palmitate moiety is essential for correct intracellular targeting and protein function. {ECO:0000269|PubMed:11017799, ECO:0000269|PubMed:8999886}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 16912323; 18094186; |
| Motif | MOTIF 153..156; /note=YPPL |
| Gene Encoded By | |
| Mass | 41,796 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |