Detail Information for IndEnz0005001418
IED ID IndEnz0005001418
Enzyme Type ID lipase001418
Protein Name Acetyl esterase
EC 3.1.1.-
Gene Name aes ybaC SSON_0463
Organism Shigella sonnei (strain Ss046)
Taxonomic Lineage cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Shigella Shigella sonnei Shigella sonnei (strain Ss046)
Enzyme Sequence MKPENKLPVLDLISAEMKTVVNTLQPDLPSWPATGTIAEQRQYYTLERRFWNAGAPEMATRAYMVPTKYGQVETRLFCPQPDSPATLFYLHGGGFILGNLDTHDRIMRLLASYSQCTVIGIDYTLSPEARFPQAIEEIVAACCYFHQQAEDYQINMSRIGFAGDSAGAMLALASALWLRDKQIDCGKIAGVLLWYGLYGLRDSVTRRLLGGVWDGLTQQDLQMYEEAYLSNDADRESPYYCLFNNDLTREVPPCFIAGAEFDPLLDDSRLLYQTLAAHQQPCEFKLYPGTLHAFLHYSRMMKTADEALRDGAQFFTAQL
Enzyme Length 319
Uniprot Accession Number Q3Z4S3
Absorption
Active Site ACT_SITE 165; /evidence=ECO:0000255|HAMAP-Rule:MF_01958; ACT_SITE 262; /evidence=ECO:0000255|HAMAP-Rule:MF_01958; ACT_SITE 292; /evidence=ECO:0000255|HAMAP-Rule:MF_01958
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number 3.1.1.-
Enzyme Function FUNCTION: Displays esterase activity towards short chain fatty esters (acyl chain length of up to 8 carbons). Able to hydrolyze triacetylglycerol (triacetin) and tributyrylglycerol (tributyrin), but not trioleylglycerol (triolein) or cholesterol oleate. Negatively regulates MalT activity by antagonizing maltotriose binding. Inhibits MelA galactosidase activity. {ECO:0000255|HAMAP-Rule:MF_01958}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Active site (3); Chain (1); Motif (1)
Keywords Cytoplasm;Hydrolase;Serine esterase
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_01958}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif MOTIF 91..93; /note=Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion hole; /evidence=ECO:0000250|UniProtKB:Q5NUF3
Gene Encoded By
Mass 36,038
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda