IED ID | IndEnz0005001442 |
Enzyme Type ID | lipase001442 |
Protein Name |
Envelope phospholipase F13 EC 3.1.1.- 37 kDa protein Envelope protein F13 Palmitoylated EV membrane protein p37K |
Gene Name | MVA043L ACAM3000_MVA_043 |
Organism | Vaccinia virus (strain Ankara) (VACV) |
Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Chitovirales Poxviridae Chordopoxvirinae Orthopoxvirus Vaccinia virus Vaccinia virus (strain Ankara) (VACV) |
Enzyme Sequence | MWPFAPVPAGAKCRLVETLPENMDFRSDHLTTFECFNEIITLAKKYIYIASFCCNPLSTTRGALIFDKLKEASEKGIKIIVLLDERGKRNLGELQSHCPDINFITVNIDKKNNVGLLLGCFWVSDNERCYVGNASFTGGSIHTIKTLGVYSDYPPLATDLRRRFDTFKAFNSAKNSWLNLCSAACCLPVSTAYHIKNPIGGVFFTDSPEHLLGYSRDLDTDVVIDKLKSAKTSIDIEHLAIVPTTRVDGNSYYWPDIYNSIIEAAINRGVKIRLLVGNWDKNDVYSMATARSLDALCVQNDLSVKVFTIQNNTKLLIVDDEYVHITSANFDGTHYQNHGFVSFNSIDKQLVSEAKKIFERDWVSSHSKSLKI |
Enzyme Length | 372 |
Uniprot Accession Number | O57179 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | 3.1.1.- |
Enzyme Function | FUNCTION: Major envelope protein that plays a role in the biogenesis of the viral double membrane and in egress of virus from the host cell. Produces the wrapped form of virus that is required for cell-to-cell spread. Acts as a lipase with broad specificity including phospholipase C, phospholipase A, and triacylglycerol lipase activities. {ECO:0000250|UniProtKB:P04021}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Domain (1); Motif (1) |
Keywords | Host Golgi apparatus;Host endoplasmic reticulum;Host membrane;Host-virus interaction;Hydrolase;Late protein;Lipoprotein;Membrane;Palmitate;Viral budding;Viral budding via the host ESCRT complexes;Viral envelope protein;Viral release from host cell;Virion |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Virion membrane {ECO:0000250|UniProtKB:P04021}; Lipid-anchor {ECO:0000250|UniProtKB:P04021}. Host Golgi apparatus, host trans-Golgi network {ECO:0000250|UniProtKB:P04021}. Host endoplasmic reticulum membrane {ECO:0000250|UniProtKB:P04021}; Lipid-anchor {ECO:0000250|UniProtKB:P04021}; Cytoplasmic side {ECO:0000250|UniProtKB:P04021}. Note=Component of the inner side of the enveloped virion (EV) membrane. F13 is associated post-translationally with membranes. {ECO:0000250|UniProtKB:P04021}. |
Modified Residue | |
Post Translational Modification | PTM: Palmitoylated. {ECO:0000250}. |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | MOTIF 153..156; /note=YPPL |
Gene Encoded By | |
Mass | 41,805 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |