| IED ID | IndEnz0007000067 |
| Enzyme Type ID | catalase000067 |
| Protein Name |
Alkyl hydroperoxide reductase C EC 1.11.1.26 Peroxiredoxin Thioredoxin peroxidase |
| Gene Name | ahpC SAOUHSC_00365 |
| Organism | Staphylococcus aureus (strain NCTC 8325 / PS 47) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus Staphylococcus aureus (strain NCTC 8325 / PS 47) |
| Enzyme Sequence | MSLINKEILPFTAQAFDPKKDQFKEVTQEDLKGSWSVVCFYPADFSFVCPTELEDLQNQYEELQKLGVNVFSVSTDTHFVHKAWHDHSDAISKITYTMIGDPSQTITRNFDVLDEATGLAQRGTFIIDPDGVVQASEINADGIGRDASTLAHKIKAAQYVRKNPGEVCPAKWEEGAKTLQPGLDLVGKI |
| Enzyme Length | 189 |
| Uniprot Accession Number | P0A0B7 |
| Absorption | |
| Active Site | ACT_SITE 49; /note=Cysteine sulfenic acid (-SOH) intermediate; /evidence=ECO:0000250|UniProtKB:P0A251 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=a hydroperoxide + H(+) + NADH = an alcohol + H2O + NAD(+); Xref=Rhea:RHEA:62628, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30879, ChEBI:CHEBI:35924, ChEBI:CHEBI:57540, ChEBI:CHEBI:57945; EC=1.11.1.26; Evidence={ECO:0000250|UniProtKB:P0A251}; |
| DNA Binding | |
| EC Number | 1.11.1.26 |
| Enzyme Function | FUNCTION: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides. Is important for survival under desiccation conditions. Not required for virulence although is necessary for nasal colonization. {ECO:0000269|PubMed:17114262}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Disulfide bond (2); Domain (1); Initiator methionine (1); Sequence conflict (2) |
| Keywords | Antioxidant;Cytoplasm;Direct protein sequencing;Disulfide bond;Oxidoreductase;Peroxidase;Redox-active center;Reference proteome |
| Interact With | |
| Induction | INDUCTION: Induced by iron and osmotic shock. Repressed under metal-depleted growth conditions and by manganese-rich growth conditions. Negatively regulated by the ferric uptake regulator (Fur) and PerR. {ECO:0000269|PubMed:14742543, ECO:0000269|PubMed:7551034}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:P0AE08}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 20,977 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:62628 |
| Cross Reference Brenda |