| IED ID | IndEnz0007000261 |
| Enzyme Type ID | catalase000261 |
| Protein Name |
Glutathione S-transferase-like protein OpS6 EC 2.5.1.- Oosporein biosynthesis protein 6 |
| Gene Name | OpS6 BBA_08184 |
| Organism | Beauveria bassiana (strain ARSEF 2860) (White muscardine disease fungus) (Tritirachium shiotae) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Sordariomycetes Hypocreomycetidae Hypocreales Cordycipitaceae Beauveria Beauveria bassiana (White muscardine disease fungus) (Tritirachium shiotae) Beauveria bassiana (strain ARSEF 2860) (White muscardine disease fungus) (Tritirachium shiotae) |
| Enzyme Sequence | MASLQPIKLYAHKKGPNPWKVALILEELGLPYETTYLEFPDAKVEPYISLNPNGKLPAIQDPNHSIELFESGAIIEYLIEQYDKDGKLSHESLQDKSLARAWLHLQMSAQAPVIGYKVWMGRTYDASQIVSANEFLTLEIKRVLGVLDKHLAKMGGPYLLGSKVSYADLAFVPHYMMLPLFVPDYDPATEYPHFAAWLAALKERPAVKKIAATKAALA |
| Enzyme Length | 218 |
| Uniprot Accession Number | J4UHQ8 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 2.5.1.- |
| Enzyme Function | FUNCTION: Glutathione S-transferase-like protein; part of the gene cluster that mediates the biosynthesis of the bibenzoquinone oosporein, a metabolite required for fungal virulence that acts by evading host immunity to facilitate fungal multiplication in insects (PubMed:26305932). The non-reducing polyketide synthase OpS1 produces orsellinic acid by condensing acetyl-CoA with 3 malonyl-CoA units (PubMed:26305932). Orsellinic acid is then hydroxylated to benzenetriol by the hydroxylase OpS4 (PubMed:26305932). The intermediate is oxidized either nonenzymatically to 5,5'-dideoxy-oosporein or enzymatically to benzenetetrol by the oxidoreductase OpS7 (PubMed:26305932). The latter is further dimerized to oosporein by the catalase OpS5 (PubMed:26305932). OpS6 probably functions en route for protecting cells against oxidative stress by scavenging any leaked free radical form of benzenetetrol by activating the thiol group of glutathione (PubMed:26305932). {ECO:0000269|PubMed:26305932}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Secondary metabolite biosynthesis. {ECO:0000269|PubMed:26305932}. |
| nucleotide Binding | |
| Features | Chain (1); Domain (2) |
| Keywords | Reference proteome;Transferase;Virulence |
| Interact With | |
| Induction | INDUCTION: Expression is positively regulated by the oosporein cluster specific regulator OpS3 that binds the promoter at a 5'-CGGA-3' motif (PubMed:26305932). Expression is negatively regulated by the global transcription factor Msn2 that binds the stress-response element 5'-AGGGG-3' (PubMed:26305932). {ECO:0000269|PubMed:26305932}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 24,380 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |