| IED ID | IndEnz0007000263 |
| Enzyme Type ID | catalase000263 |
| Protein Name |
Peroxisome assembly protein 26 Peroxin-26 |
| Gene Name | PEX26 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MKSDSSTSAAPLRGLGGPLRSSEPVRAVPARAPAVDLLEEAADLLVVHLDFRAALETCERAWQSLANHAVAEEPAGTSLEVKCSLCVVGIQALAEMDRWQEVLSWVLQYYQVPEKLPPKVLELCILLYSKMQEPGAVLDVVGAWLQDPANQNLPEYGALAEFHVQRVLLPLGCLSEAEELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHKFLSLPMLVRQLWDSAVSHFFSLPFKKSLLAALILCLLVVRFDPASPSSLHFLYKLAQLFRWIRKAAFSRLYQLRIRD |
| Enzyme Length | 305 |
| Uniprot Accession Number | Q7Z412 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Probably required for protein import into peroxisomes. Anchors PEX1 and PEX6 to peroxisome membranes, possibly to form heteromeric AAA ATPase complexes required for the import of proteins into peroxisomes. Involved in the import of catalase and proteins containing a PTS2 target sequence, but not in import of proteins with a PTS1 target sequence. {ECO:0000269|PubMed:12717447, ECO:0000269|PubMed:12851857}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (1); Chain (1); Erroneous termination (1); Natural variant (4); Region (1); Sequence conflict (1); Topological domain (2); Transmembrane (1) |
| Keywords | Alternative splicing;Disease variant;Membrane;Peroxisome;Peroxisome biogenesis disorder;Protein transport;Reference proteome;Signal-anchor;Transmembrane;Transmembrane helix;Transport;Zellweger syndrome |
| Interact With | Q6PCB6; P63010-2; Q0P5N6; Q6XD76; Q9UQB8-3; Q9BUW7; O15392; Q96LC9; Q5JTY5; Q9UNS2; Q9UER7; A0AVK6; Q5JUQ0; Q6PIV2; Q969S8; Q6DN90-2; Q96SI1-2; Q6P597; Q8IUB9; Q8IUC2; Q9H2C1; Q6ZP95; P50221; A4FUJ8; Q13064; Q9Y3D2; O76041; P40855; Q99471; Q9ULX5; Q6UVJ0; Q9UMX1; P04637; Q9GZS3; Q96NC0; Q7Z783 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Peroxisome membrane {ECO:0000269|PubMed:12717447}; Single-pass type II membrane protein {ECO:0000269|PubMed:12717447}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10430017; 10704444; 11390669; 11402059; 11453642; 11590176; 11883941; 12751901; 12924628; 14709540; 15007061; 15713480; 15781447; 15858711; 16007078; 16189514; 16257970; 16280322; 16763195; 16791427; 16854980; 16895967; 16911527; 16980692; 17069900; 18174172; 18782765; 20531392; 20554521; 20711500; 21102411; 21980954; 22624858; 23460677; 23628762; 24865970; 25016021; 25062251; 25517356; 26627908; 26777132; 28281558; 28325759; 28521612; 28611990; 30366024; 30446579; 31831025; 9418908; 9539740; |
| Motif | |
| Gene Encoded By | |
| Mass | 33,898 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |