| IED ID | IndEnz0007000426 |
| Enzyme Type ID | catalase000426 |
| Protein Name |
DNA protection during starvation protein EC 1.16.-.- Nutrient stress-induced DNA-binding protein |
| Gene Name | dps dpsA Synpcc7942_2171 |
| Organism | Synechococcus elongatus (strain PCC 7942 / FACHB-805) (Anacystis nidulans R2) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Cyanobacteria/Melainabacteria group Cyanobacteria Synechococcales Synechococcaceae Synechococcus Synechococcus elongatus Synechococcus elongatus (strain PCC 7942 / FACHB-805) (Anacystis nidulans R2) |
| Enzyme Sequence | MTNTGLVQSFSQIEPNVLGLETSVTSQICEGLNRALASFQVLYLQYQKHHFTVQGAEFYSLHEFFEDSYGSVKDHVHDLGERLNGLGGVPVAHPLKLAELTCFAIEEDGVFNCRTMLEHDLAAEQAILSLLRRLTAQVESLGDRATRYLLEGILLKTEERAYHIAHFLAPDSLKLA |
| Enzyme Length | 176 |
| Uniprot Accession Number | Q55024 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=2 Fe(2+) + 2 H(+) + H2O2 = 2 Fe(3+) + 2 H2O; Xref=Rhea:RHEA:48712, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:16240, ChEBI:CHEBI:29033, ChEBI:CHEBI:29034; |
| DNA Binding | |
| EC Number | 1.16.-.- |
| Enzyme Function | FUNCTION: Protects DNA from oxidative damage by sequestering intracellular Fe(2+) ion and storing it in the form of Fe(3+) oxyhydroxide mineral. One hydrogen peroxide oxidizes two Fe(2+) ions, which prevents hydroxyl radical production by the Fenton reaction (By similarity). Dps binds the chromosome non-specifically, forming a highly ordered and stable dps-DNA co-crystal within which chromosomal DNA is condensed and protected from diverse damages. Soluble dps might function in iron homeostasis under high iron concentration, while the dps-DNA complex might associate with the protection of DNA from oxidative stress at low iron concentration. Has a weak catalase activity in vitro. {ECO:0000250, ECO:0000269|PubMed:7673237}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Metal binding (4); Sequence conflict (2) |
| Keywords | Cytoplasm;DNA condensation;DNA-binding;Direct protein sequencing;Heme;Iron;Iron storage;Metal-binding;Oxidoreductase |
| Interact With | |
| Induction | INDUCTION: The dps-DNA complex accumulates during stationary phase and under nitrogen, sulfur, and phosphate stress, but not under iron limitation. {ECO:0000269|PubMed:7794101}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:12442298}. Note=The dps-DNA complex is found in the cytoplasm whereas a soluble dps is localized preferentially to the thylakoid membrane and is also found in the cell envelope. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 19,659 |
| Kinetics | |
| Metal Binding | METAL 50; /note=Iron 1; shared with dodecameric partner; /evidence=ECO:0000250; METAL 78; /note=Iron 1; /evidence=ECO:0000250; METAL 81; /note=Iron 1; /evidence=ECO:0000250; METAL 81; /note=Iron 2; /evidence=ECO:0000250 |
| Rhea ID | RHEA:48712 |
| Cross Reference Brenda |