| IED ID | IndEnz0007000427 |
| Enzyme Type ID | catalase000427 |
| Protein Name |
Cytochrome b-245 chaperone 1 Essential for reactive oxygen species protein Eros |
| Gene Name | CYBC1 C17orf62 EROS |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MYLQVETRTSSRLHLKRAPGIRSWSLLVGILSIGLAAAYYSGDSLGWKLFYVTGCLFVAVQNLEDWEEAIFDKSTGKVVLKTFSLYKKLLTLFRAGHDQVVVLLHDVRDVSVEEEKVRYFGKGYMVVLRLATGFSHPLTQSAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS |
| Enzyme Length | 187 |
| Uniprot Accession Number | Q9BQA9 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Functions as a chaperone necessary for a stable expression of the CYBA and CYBB subunits of the cytochrome b-245 heterodimer (PubMed:30361506). Controls the phagocyte respiratory burst and is essential for innate immunity (By similarity). {ECO:0000250|UniProtKB:Q3TYS2, ECO:0000269|PubMed:30361506}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (1); Chain (1); Modified residue (1); Natural variant (1); Sequence caution (1); Transmembrane (1) |
| Keywords | Alternative splicing;Chaperone;Chronic granulomatous disease;Disease variant;Endoplasmic reticulum;Immunity;Innate immunity;Membrane;Phosphoprotein;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | Q15848; Q6RW13-2; Q8IVF2-3; Q9NVV5-2; Q8NCL9; P02652; Q9BQE5; Q96PS8; Q13520; O94778; O15155; Q8WVX3-2; P19397; Q8N5K1; O95471; Q9NWW5; O75208; Q7Z7G2; P04839; Q9Y282; P14921; Q5JX71; P48165; Q8TDV0; Q8TDT2; Q8NBQ5; Q7Z5P4; Q9Y5U4; Q8N5M9; Q8N6L0; P43628; O43561-2; Q9BS40; Q9GZY8-5; Q5SR56; O14880; Q9H2K0; Q9NZG7; Q9HBY0; Q8N912; Q8IXM6; P51575; Q13113; O00623; O60664; P60201-2; Q04941; O00767; Q96DD7; Q9NQQ7-3; P16150; Q8WWF3; P32856-2; P07204; Q96DZ7; Q5BJH2-2; Q96HE8; O15393-2; Q9Y320; Q8N609; O95859 |
| Induction | INDUCTION: In macrophages, expression is induced after treatment with IFNG or a combination of IFNG and Salmonella Tiphimurium. {ECO:0000269|PubMed:28351984}. |
| Subcellular Location | SUBCELLULAR LOCATION: Endoplasmic reticulum membrane {ECO:0000269|PubMed:28351984}; Single-pass membrane protein {ECO:0000305}. |
| Modified Residue | MOD_RES 168; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q6AYA6 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 18464913; 20195357; 21516116; 25416956; 30312704; 31862710; 34280579; |
| Motif | |
| Gene Encoded By | |
| Mass | 20,774 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |