| IED ID | IndEnz0007000448 |
| Enzyme Type ID | catalase000448 |
| Protein Name |
Bacterioferritin BFR EC 1.16.3.1 |
| Gene Name | bfr |
| Organism | Pseudomonas putida (Arthrobacter siderocapsulatus) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Pseudomonadales Pseudomonadaceae Pseudomonas Pseudomonas putida group Pseudomonas putida (Arthrobacter siderocapsulatus) |
| Enzyme Sequence | MQGHPDVINYLVTLLKGELAARDQYFIHSRMYEDWGLTKLYERINHEMEEETQHADALMRRILMLEGTPDMRADDLEVGSTVPEMIEADLKLEYKVRGALCKGIELCELHKDYISRDILRAQLADTEEDHTYWLEKQQGLIKAIGLENYLQSQM |
| Enzyme Length | 154 |
| Uniprot Accession Number | P77930 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=4 Fe(2+) + 4 H(+) + O2 = 4 Fe(3+) + 2 H2O; Xref=Rhea:RHEA:11148, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:15379, ChEBI:CHEBI:29033, ChEBI:CHEBI:29034; EC=1.16.3.1; |
| DNA Binding | |
| EC Number | 1.16.3.1 |
| Enzyme Function | FUNCTION: Iron-storage protein, whose ferroxidase center binds Fe(2+) ions, oxidizes them by dioxygen to Fe(3+), and participates in the subsequent Fe(3+) oxide mineral core formation within the central cavity of the protein complex. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Metal binding (9) |
| Keywords | Heme;Iron;Iron storage;Metal-binding;Oxidoreductase |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 18,001 |
| Kinetics | |
| Metal Binding | METAL 18; /note=Iron 1; /evidence=ECO:0000255|PROSITE-ProRule:PRU00085; METAL 48; /note=Iron (heme b axial ligand); shared with dimeric partner; /evidence=ECO:0000255|PROSITE-ProRule:PRU00085; METAL 51; /note=Iron 1; /evidence=ECO:0000255|PROSITE-ProRule:PRU00085; METAL 51; /note=Iron 2; /evidence=ECO:0000255|PROSITE-ProRule:PRU00085; METAL 54; /note=Iron 1; /evidence=ECO:0000255|PROSITE-ProRule:PRU00085; METAL 93; /note=Iron 2; /evidence=ECO:0000255|PROSITE-ProRule:PRU00085; METAL 127; /note=Iron 1; /evidence=ECO:0000255|PROSITE-ProRule:PRU00085; METAL 127; /note=Iron 2; /evidence=ECO:0000255|PROSITE-ProRule:PRU00085; METAL 130; /note=Iron 2; /evidence=ECO:0000255|PROSITE-ProRule:PRU00085 |
| Rhea ID | RHEA:11148 |
| Cross Reference Brenda |