| IED ID | IndEnz0007000542 |
| Enzyme Type ID | catalase000542 |
| Protein Name |
Probable inactive reductase easA Ergot alkaloid synthesis protein A |
| Gene Name | easA |
| Organism | Epichloe festucae var. lolii (Neotyphodium lolii) (Acremonium lolii) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Sordariomycetes Hypocreomycetidae Hypocreales Clavicipitaceae Epichloe Epichloe festucae Epichloe festucae var. lolii (Neotyphodium lolii) (Acremonium lolii) |
| Enzyme Sequence | MSTSNLFTPLQFGKCLLQHKLVLSPMTRFRADNEGVPLPYVKTYYCQRASLPGTLLLTEATAISRRARGFPNVPGIWSQEQIAGWKEVVDAVHAKGSYIWLQLWATGRAAEVGVLKANGFDLVSSSAVPVSPGEPTPRALSDDEINSYIGDFVQAAKNAVLEAGFDGVELHGANGFLIDQFLQSPCNQRTDQWGGCIENRSRFGLEITRRVIDAVGKDHVGMKLSTWSTFQGMGTMDDLIPQFEHFIMRLREIGIAYLHLANSRWVEEEDPTIRTHPDIHNETFVRMWGKEKPVLLAGGYGPESAKLVVDETYSDHKNIGVVFGRHYISNPDLPFRLKMGLPLQKYNRETFYIPFSDEGYLDYPYSEEYITENKKQAVLA |
| Enzyme Length | 380 |
| Uniprot Accession Number | A2TBU0 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | BINDING 60; /note=FMN; via amide nitrogen; /evidence=ECO:0000250|UniProtKB:Q4WZ70; BINDING 102; /note=FMN; /evidence=ECO:0000250|UniProtKB:Q4WZ70; BINDING 171; /note=FMN; /evidence=ECO:0000250|UniProtKB:Q4WZ70; BINDING 171; /note=Substrate; /evidence=ECO:0000250|UniProtKB:Q02899; BINDING 174; /note=Substrate; /evidence=ECO:0000250|UniProtKB:Q02899; BINDING 223; /note=FMN; /evidence=ECO:0000250|UniProtKB:Q4WZ70; BINDING 299; /note=FMN; via amide nitrogen; /evidence=ECO:0000250|UniProtKB:Q4WZ70; BINDING 325; /note=FMN; /evidence=ECO:0000250|UniProtKB:Q02899; BINDING 352; /note=Substrate; /evidence=ECO:0000250|UniProtKB:Q02899 |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Probable inactive dehydrogenase; part of the gene cluster that mediates the biosynthesis of fungal ergot alkaloid ergovaline, the predominant ergopeptine product in E.festucae var. lolii (PubMed:17308187). DmaW catalyzes the first step of ergot alkaloid biosynthesis by condensing dimethylallyl diphosphate (DMAP) and tryptophan to form 4-dimethylallyl-L-tryptophan (By similarity). The second step is catalyzed by the methyltransferase easF that methylates 4-dimethylallyl-L-tryptophan in the presence of S-adenosyl-L-methionine, resulting in the formation of 4-dimethylallyl-L-abrine (By similarity). The catalase easC and the FAD-dependent oxidoreductase easE then transform 4-dimethylallyl-L-abrine to chanoclavine-I which is further oxidized by easD in the presence of NAD(+), resulting in the formation of chanoclavine-I aldehyde (By similarity). Agroclavine dehydrogenase easG then mediates the conversion of chanoclavine-I aldehyde to agroclavine via a non-enzymatic adduct reaction: the substrate is an iminium intermediate that is formed spontaneously from chanoclavine-I aldehyde in the presence of glutathione (By similarity). The presence of easA is not required to complete this reaction (By similarity). Further conversion of agroclavine to paspalic acid is a two-step process involving oxidation of agroclavine to elymoclavine and of elymoclavine to paspalic acid, the second step being performed by the elymoclavine oxidase cloA (By similarity). Paspalic acid is then further converted to D-lysergic acid (By similarity). Ergovaline is assembled from D-lysergic acid and three different amino acids by the D-lysergyl-peptide-synthetase composed of a monomudular (lpsB) and a trimodular (lpsA) nonribosomal peptide synthetase subunit (PubMed:17308187, PubMed:11592979). {ECO:0000250|UniProtKB:Q50EL0, ECO:0000269|PubMed:11592979, ECO:0000269|PubMed:17308187}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | NP_BIND 25..27; /note=FMN; /evidence=ECO:0000250|UniProtKB:Q4WZ70; NP_BIND 324..325; /note=FMN; /evidence=ECO:0000250|UniProtKB:Q4WZ70 |
| Features | Binding site (9); Chain (1); Nucleotide binding (2) |
| Keywords | Alkaloid metabolism;FMN;Flavoprotein;NADP |
| Interact With | |
| Induction | INDUCTION: Strongly expressed in planta but not expressed in axenic culture (PubMed:17308187). {ECO:0000269|PubMed:17308187}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 42,697 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |