| IED ID | IndEnz0007000545 |
| Enzyme Type ID | catalase000545 |
| Protein Name |
4-dimethylallyltryptophan N-methyltransferase easF EC 2.1.1.261 4-dimethylallyltryptophan methyltransferase Ergot alkaloid synthesis protein F |
| Gene Name | easF |
| Organism | Claviceps fusiformis (Ergot fungus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Sordariomycetes Hypocreomycetidae Hypocreales Clavicipitaceae Claviceps Claviceps fusiformis (Ergot fungus) |
| Enzyme Sequence | MPACSVTDIRSHVVEDSLPDQVIKGLKSSPKTLPALLFYSNEGLDHWNHHVSQPDFYPRHQEVDILKQRGDEMARAIAPNSVILDLGSANLEKVVHLLKALEAQGKDVTYFALDISAPQLEVTLNEIPTSEFRHVRFAGLHGTFEDGLRWISETPHICDLPHCVLLLGLTIGNFSRASAATFLGNIASQALRGASKDQSSILMSLDSCKVPTQILRAYTSNGVEPFALQSLTFAKTLLRGPMLHNDSDEPLPCYLQPDDWYYHSEWNFVLGRHEASLIPRYRDVHLGSLLQDITVKKDEKIRFGCSYKYDDMERHQLFLDAGVEQDVAWTNEGCDVVIYELKKRSNTEKLGIDRN |
| Enzyme Length | 355 |
| Uniprot Accession Number | A8C7S0 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=4-(3-methylbut-2-enyl)-L-tryptophan + S-adenosyl-L-methionine = 4-(3-methylbut-2-enyl)-L-abrine + H(+) + S-adenosyl-L-homocysteine; Xref=Rhea:RHEA:34435, ChEBI:CHEBI:15378, ChEBI:CHEBI:57856, ChEBI:CHEBI:58209, ChEBI:CHEBI:59789, ChEBI:CHEBI:67248; EC=2.1.1.261; Evidence={ECO:0000250|UniProtKB:B6D5I7}; |
| DNA Binding | |
| EC Number | 2.1.1.261 |
| Enzyme Function | FUNCTION: 4-dimethylallyltryptophan N-methyltransferase; part of the gene cluster that mediates the biosynthesis of fungal ergot alkaloid (PubMed:17720822). DmaW catalyzes the first step of ergot alkaloid biosynthesis by condensing dimethylallyl diphosphate (DMAP) and tryptophan to form 4-dimethylallyl-L-tryptophan (By similarity). The second step is catalyzed by the methyltransferase easF that methylates 4-dimethylallyl-L-tryptophan in the presence of S-adenosyl-L-methionine, resulting in the formation of 4-dimethylallyl-L-abrine (By similarity). The catalase easC and the FAD-dependent oxidoreductase easE then transform 4-dimethylallyl-L-abrine to chanoclavine-I which is further oxidized by easD in the presence of NAD(+), resulting in the formation of chanoclavine-I aldehyde (By similarity). Agroclavine dehydrogenase easG then mediates the conversion of chanoclavine-I aldehyde to agroclavine via a non-enzymatic adduct reaction: the substrate is an iminium intermediate that is formed spontaneously from chanoclavine-I aldehyde in the presence of glutathione (By similarity). Further conversion of agroclavine to paspalic acid is a two-step process involving oxidation of agroclavine to elymoclavine and of elymoclavine to paspalic acid, the second step being performed by the elymoclavine oxidase cloA (PubMed:17720822). However, cloA does not encode a functional enzyme indicating that C.fusiformis terminates its ergot alkaloid pathway at elymoclavine (PubMed:17720822). {ECO:0000250|UniProtKB:Q5G5T6, ECO:0000269|PubMed:17720822}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Alkaloid biosynthesis; ergot alkaloid biosynthesis. {ECO:0000305|PubMed:17720822}. |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Alkaloid metabolism;Methyltransferase;S-adenosyl-L-methionine;Transferase |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 39,955 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:34435 |
| Cross Reference Brenda |