| IED ID | IndEnz0007000567 |
| Enzyme Type ID | catalase000567 |
| Protein Name |
Probable soluble cytochrome b562 1 Cytochrome b-562 1 |
| Gene Name | cybC1 cybC YPO3320 y0869 YP_0366 |
| Organism | Yersinia pestis |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Yersiniaceae Yersinia Yersinia pseudotuberculosis complex Yersinia pestis |
| Enzyme Sequence | MRKIPIIAGVFSLLITSCTFAASLQDDMNILIANLGIVSSSTDTKVITSSLEKMRNAALDAQKAIPPKLEGKAEDSPEIKDYRHGFDLLIEQIDKTKQWAEEGNIQEVKKSVGEVINIRNTYHSRYR |
| Enzyme Length | 127 |
| Uniprot Accession Number | Q9X6B1 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Electron-transport protein of unknown function. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Erroneous initiation (1); Metal binding (2); Signal peptide (1) |
| Keywords | Electron transport;Heme;Iron;Metal-binding;Periplasm;Reference proteome;Signal;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Periplasm {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 14,192 |
| Kinetics | |
| Metal Binding | METAL 28; /note=Iron (heme B axial ligand); /evidence=ECO:0000250; METAL 123; /note=Iron (heme B axial ligand); /evidence=ECO:0000250 |
| Rhea ID | |
| Cross Reference Brenda |