| IED ID | IndEnz0007000590 |
| Enzyme Type ID | catalase000590 |
| Protein Name |
Photosystem II core complex proteins psbY, chloroplastic L-arginine-metabolizing enzyme L-AME Cleaved into: Photosystem II protein psbY-1, chloroplastic psbY-A1 ; Photosystem II protein psbY-2, chloroplastic psbY-A2 |
| Gene Name | PSBY |
| Organism | Spinacia oleracea (Spinach) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae Caryophyllales Chenopodiaceae Chenopodioideae Anserineae Spinacia Spinacia oleracea (Spinach) |
| Enzyme Sequence | MAATMATTMAVLNTKCLTLNTNKTTSTSPKPTSKPISLSPLGLSNSKLPMGLSPIITAPAIAGAVFATLGSVDPAFAVQQLADIAAEAGTSDNRGLALLLPIIPALGWVLFNILQPALNQINKMRNEKKAFIVGLGLSGLATSGLLLATPEAQAASEEIARGSDNRGTLLLLVVLPAIGWVLFNILQPALNQLNKMRSQ |
| Enzyme Length | 199 |
| Uniprot Accession Number | P80470 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: PSBY-1 and -2 are manganese-binding polypeptides with L-arginine metabolizing enzyme activity. They are a component of the core of photosystem II. They have also a minor catalase-like activity since they cause evolution of oxygen from hydrogen peroxide in a reaction stimulated by manganese. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Propeptide (1); Topological domain (4); Transit peptide (1); Transmembrane (3) |
| Keywords | Chloroplast;Direct protein sequencing;Manganese;Membrane;Photosynthesis;Photosystem II;Plastid;Repeat;Thylakoid;Transit peptide;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | INDUCTION: Photocontrolled. Steady-state concentrations increase for the first 3 hours of illumination and then decline. |
| Subcellular Location | SUBCELLULAR LOCATION: Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 20,664 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 1.97.1.12; |