IED ID |
IndEnz0007000641 |
Enzyme Type ID |
catalase000641 |
Protein Name |
Transcriptional regulator FurA
|
Gene Name |
furA fur MT1960 |
Organism |
Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Actinobacteria
Actinomycetia (high G+C Gram-positive bacteria)
Corynebacteriales
Mycobacteriaceae
Mycobacterium
Mycobacterium tuberculosis complex
Mycobacterium tuberculosis
Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
|
Enzyme Sequence |
MSSIPDYAEQLRTADLRVTRPRVAVLEAVNAHPHADTETIFGAVRFALPDVSRQAVYDVLHALTAAGLVRKIQPSGSVARYESRVGDNHHHIVCRSCGVIADVDCAVGEAPCLTASDHNGFLLDEAEVIYWGLCPDCSISDTSRSHP |
Enzyme Length |
147 |
Uniprot Accession Number |
P9WN86 |
Absorption |
|
Active Site |
|
Activity Regulation |
|
Binding Site |
|
Calcium Binding |
|
catalytic Activity |
|
DNA Binding |
|
EC Number |
|
Enzyme Function |
FUNCTION: Represses transcription of the catalase-peroxidase gene katG and its own transcription by binding to the promoter region in a redox-dependent manner. {ECO:0000250}. |
Temperature Dependency |
|
PH Dependency |
|
Pathway |
|
nucleotide Binding |
|
Features |
Chain (1); Erroneous initiation (1); Metal binding (9); Region (2) |
Keywords |
Cytoplasm;DNA-binding;Iron;Metal-binding;Repressor;Transcription;Transcription regulation;Zinc |
Interact With |
|
Induction |
|
Subcellular Location |
SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. |
Modified Residue |
|
Post Translational Modification |
|
Signal Peptide |
|
Structure 3D |
|
Cross Reference PDB |
- |
Mapped Pubmed ID |
- |
Motif |
|
Gene Encoded By |
|
Mass |
15,892 |
Kinetics |
|
Metal Binding |
METAL 34; /note=Zinc; /evidence=ECO:0000250; METAL 82; /note=Zinc; /evidence=ECO:0000250; METAL 87; /note=Iron; /evidence=ECO:0000250; METAL 89; /note=Iron; /evidence=ECO:0000250; METAL 91; /note=Zinc; /evidence=ECO:0000250; METAL 94; /note=Zinc; /evidence=ECO:0000250; METAL 97; /note=Zinc; /evidence=ECO:0000250; METAL 102; /note=Zinc; /evidence=ECO:0000250; METAL 109; /note=Iron; /evidence=ECO:0000250 |
Rhea ID |
|
Cross Reference Brenda |
|