| IED ID |
IndEnz0007000642 |
| Enzyme Type ID |
catalase000642 |
| Protein Name |
Transcriptional regulator FurA
|
| Gene Name |
furA fur Rv1909c MTCY180.09 |
| Organism |
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Actinobacteria
Actinomycetia (high G+C Gram-positive bacteria)
Corynebacteriales
Mycobacteriaceae
Mycobacterium
Mycobacterium tuberculosis complex
Mycobacterium tuberculosis
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
|
| Enzyme Sequence |
MSSIPDYAEQLRTADLRVTRPRVAVLEAVNAHPHADTETIFGAVRFALPDVSRQAVYDVLHALTAAGLVRKIQPSGSVARYESRVGDNHHHIVCRSCGVIADVDCAVGEAPCLTASDHNGFLLDEAEVIYWGLCPDCSISDTSRSHP |
| Enzyme Length |
147 |
| Uniprot Accession Number |
P9WN87 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Represses transcription of the catalase-peroxidase gene katG and its own transcription by binding to the promoter region in a redox-dependent manner. {ECO:0000269|PubMed:11401695, ECO:0000269|PubMed:12949087}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Metal binding (9); Region (2) |
| Keywords |
Cytoplasm;DNA-binding;Iron;Metal-binding;Reference proteome;Repressor;Transcription;Transcription regulation;Zinc |
| Interact With |
|
| Induction |
INDUCTION: Negatively autoregulated. {ECO:0000269|PubMed:11401695, ECO:0000269|PubMed:12949087}. |
| Subcellular Location |
SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
15,892 |
| Kinetics |
|
| Metal Binding |
METAL 34; /note=Zinc; /evidence=ECO:0000250; METAL 82; /note=Zinc; /evidence=ECO:0000250; METAL 87; /note=Iron; /evidence=ECO:0000250; METAL 89; /note=Iron; /evidence=ECO:0000250; METAL 91; /note=Zinc; /evidence=ECO:0000250; METAL 94; /note=Zinc; /evidence=ECO:0000250; METAL 97; /note=Zinc; /evidence=ECO:0000250; METAL 102; /note=Zinc; /evidence=ECO:0000250; METAL 109; /note=Iron; /evidence=ECO:0000250 |
| Rhea ID |
|
| Cross Reference Brenda |
|