| IED ID |
IndEnz0007000684 |
| Enzyme Type ID |
catalase000684 |
| Protein Name |
30S ribosomal protein S11
|
| Gene Name |
rpsK BQ2027_MB3488C |
| Organism |
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Actinobacteria
Actinomycetia (high G+C Gram-positive bacteria)
Corynebacteriales
Mycobacteriaceae
Mycobacterium
Mycobacterium tuberculosis complex
Mycobacterium tuberculosis
Mycobacterium bovis
Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
|
| Enzyme Sequence |
MPPAKKGPATSARKGQKTRRREKKNVPHGAAHIKSTFNNTIVTITDPQGNVIAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQDHGVRKVDVFVKGPGSGRETAIRSLQAAGLEVGAISDVTPQPHNGVRPPNRRRV |
| Enzyme Length |
139 |
| Uniprot Accession Number |
P45812 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Located on the platform of the 30S subunit, it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome. {ECO:0000255|HAMAP-Rule:MF_01310}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Compositional bias (1); Frameshift (1); Region (1); Sequence conflict (7) |
| Keywords |
RNA-binding;Ribonucleoprotein;Ribosomal protein;rRNA-binding |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
14,771 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|