| IED ID | IndEnz0007000691 |
| Enzyme Type ID | catalase000691 |
| Protein Name |
HTH-type transcriptional regulator RipA Repressor of iron proteins A RIPA |
| Gene Name | ripA DIP0922 |
| Organism | Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Corynebacteriales Corynebacteriaceae Corynebacterium Corynebacterium diphtheriae Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) |
| Enzyme Sequence | MSLPSIKTTNSYCVVLWCDQGSATINAPDRVVQVMAGDVVLAPHGAFVTGHGVVLPMAFPDFDGGEHTRRLHMGTAWSKRMIFEFSRSLLGETRPSECIAALFDDRARPPRVPEPQAARKVAQKLIAYPADQTPLLEFAQLHNISSRTLQRQFVASTGFTFSEWRAALRVSVAADLLAHDFRIGQVSQMVGFSATSSLTRAFKRHTGDTPSSFTSPRMHAVCEQQPPMIPATTTFARASDDIALWIYSGTATVTTPGYCRFMGAGETVTIPSGTSTRLDVSAGSVALPVPLAAAHDDLTLSDVLAASVNPLAAVELQRLSAQERADVEQVLVPSV |
| Enzyme Length | 335 |
| Uniprot Accession Number | Q6NI56 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 136..157; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00593; DNA_BIND 183..206; /note=H-T-H motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU00593 |
| EC Number | |
| Enzyme Function | FUNCTION: Under iron limitation, represses the acn (aconitase), catA (catechol 1,2 dioxygenase), leuCD (isopropylmalate dehydratase), narKGHJI (nitrite/nitrate transporter and nitrate reductase), sdhCAB (succinate dehydrogenase), pta (phosphotransacetylase) and katA (catalase) genes. {ECO:0000250|UniProtKB:Q8NRR3}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); DNA binding (2); Domain (1) |
| Keywords | DNA-binding;Reference proteome;Repressor;Transcription;Transcription regulation |
| Interact With | |
| Induction | INDUCTION: Repressed by DtxR under iron excess. {ECO:0000250|UniProtKB:Q8NRR3}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 36,067 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |