| IED ID | IndEnz0007000716 |
| Enzyme Type ID | catalase000716 |
| Protein Name |
Peroxide stress resistance protein YaaA UPF0246 protein YaaA |
| Gene Name | yaaA b0006 JW0005 |
| Organism | Escherichia coli (strain K12) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
| Enzyme Sequence | MLILISPAKTLDYQSPLTTTRYTLPELLDNSQQLIHEARKLTPPQISTLMRISDKLAGINAARFHDWQPDFTPANARQAILAFKGDVYTGLQAETFSEDDFDFAQQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENARGKDLYQFWGDIITNKLNEALAAQGDNVVINLASDEYFKSVKPKKLNAEIIKPVFLDEKNGKFKIISFYAKKARGLMSRFIIENRLTKPEQLTGFNSEGYFFDEDSSSNGELVFKRYEQR |
| Enzyme Length | 258 |
| Uniprot Accession Number | P0A8I3 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Involved in the cellular response to hydrogen peroxide (H(2)O(2)) stress. During H(2)O(2) stress, prevents oxidative damage to both DNA and proteins by diminishing the amount of unincorporated iron within the cell. {ECO:0000269|PubMed:21378183}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (13); Chain (1); Helix (14); Turn (2) |
| Keywords | 3D-structure;Reference proteome;Stress response |
| Interact With | |
| Induction | INDUCTION: Induced by H(2)O(2), via OxyR. {ECO:0000269|PubMed:21378183}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 5CAJ; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 29,586 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |