| IED ID | IndEnz0008000047 |
| Enzyme Type ID | cellulase000047 |
| Protein Name |
Endoglucanase cel12A EC 3.2.1.4 Cellulase cel12A Endo-1,4-beta-glucanase cel12A |
| Gene Name | cel12A MGG_00677 |
| Organism | Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Sordariomycetes Sordariomycetidae Magnaporthales Pyriculariaceae Pyricularia Magnaporthe oryzae (Rice blast fungus) (Pyricularia oryzae) Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae) |
| Enzyme Sequence | MKTSAALLFLVSLASAAPMTPSPAAEAAAVLEGRQIQTLCDQYGYWSGNGYYVNNNMWGKDSGSGSQCTYIDSSSANHVSWRSTWQWSGGQNNVKSYPYSGRTIQRGRTIASINSMPSVVQWNYNNGNIRANVAYDLFTSTDPNRDNTHGDYELMVWLGRYGDVQPIGSQIGNANVGGRNWQLWSGLNNGMRVYSFVTTQGAITYFNADIKQFFTYLQQSQGFPASQQYLTTFQFGTEPFTGGQTTFQVNSFGANVQ |
| Enzyme Length | 257 |
| Uniprot Accession Number | G4NAZ1 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Endohydrolysis of (1->4)-beta-D-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.; EC=3.2.1.4; Evidence={ECO:0000269|PubMed:20680265}; |
| DNA Binding | |
| EC Number | 3.2.1.4 |
| Enzyme Function | FUNCTION: Endoglucanase that functions in part to hydrolyze 1,3-1,4-beta-glucan during infection and spore formation. Shows preferential hydrolysis of barley beta-glucan and lichenan. {ECO:0000269|PubMed:20680265}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 30-50 degrees Celsius. {ECO:0000269|PubMed:20680265}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 6.0-7.5. {ECO:0000269|PubMed:20680265}; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Cellulose degradation;Glycosidase;Hydrolase;Polysaccharide degradation;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | INDUCTION: Levels of expression are constitutively high during infection and spore formation. {ECO:0000269|PubMed:20680265}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..16; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 28,386 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=0.9 mg/ml for barley beta-glucan (when expressed in M.oryzae) {ECO:0000269|PubMed:20680265}; KM=2.87 mg/ml for barley beta-glucan (when expressed in B.choshinensis) {ECO:0000269|PubMed:20680265}; |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |