| IED ID | IndEnz0008000098 |
| Enzyme Type ID | cellulase000098 |
| Protein Name |
Secondary metabolism regulator LAE1 Methyltransferase LAE1 EC 2.1.1.- Velvet complex subunit LAE1 |
| Gene Name | LAE1 TRIREDRAFT_41617 |
| Organism | Hypocrea jecorina (strain QM6a) (Trichoderma reesei) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Sordariomycetes Hypocreomycetidae Hypocreales Hypocreaceae Trichoderma Hypocrea jecorina (Trichoderma reesei) Hypocrea jecorina (strain QM6a) (Trichoderma reesei) |
| Enzyme Sequence | MSRNAPNGCVPPSQATAPPSPATSLRLTVGEPVSEPATESGERVLQDGFWEHGRFYGSWKPGKYLFPIDKEELNRLDVFHKYFLVARDEKVTSTPLRKDGRPKIMDLGTGTGIWAYNVVEEYAKDAEIMAVDLNQIQPALIPRGVTTKQFDIEEPSWDPLLRDCELIHMRLLYGSIRDDKWPHVYRKAFEHLAPGIGYIEQLEIDWMPRWENEDLPRHSALQEWAQLFQRAMHRYHRSVTVSGEATRRRMEAAGFTDFSETTIRCYVNPWSPDRHQRECARWFNLAFSLGLEAMSMMPMIDKLGMTKDDIVDLCSRAKKEMCILRYRAYCTL |
| Enzyme Length | 332 |
| Uniprot Accession Number | G0RNN3 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=L-methionyl-[protein] + S-adenosyl-L-methionine = S-adenosyl-L-homocysteine + S-methyl-L-methionyl-[protein]; Xref=Rhea:RHEA:60560, Rhea:RHEA-COMP:12313, Rhea:RHEA-COMP:15592, ChEBI:CHEBI:16044, ChEBI:CHEBI:57856, ChEBI:CHEBI:59789, ChEBI:CHEBI:142742; Evidence={ECO:0000250|UniProtKB:C8VQG9};PhysiologicalDirection=left-to-right; Xref=Rhea:RHEA:60561; Evidence={ECO:0000250|UniProtKB:C8VQG9}; |
| DNA Binding | |
| EC Number | 2.1.1.- |
| Enzyme Function | FUNCTION: Methyltransferase that performs automethylation (By similarity). No other methyl-accepting substrate has been identified yet (By similarity). Component of the velvet transcription factor complex that acts as a global regulator for secondary metabolite gene expression (PubMed:23390613, PubMed:24909838). Required for the expression of VEL1 (PubMed:23390613). Regulates expression of the carbohydrate-active enzyme gene clusters, but does not act by directly modulating H3K4 or H3K9 methylation (PubMed:22554051). Required for conidiation (PubMed:22554051). {ECO:0000250|UniProtKB:C8VQG9, ECO:0000269|PubMed:22554051, ECO:0000269|PubMed:24909838}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Erroneous gene model prediction (2); Region (1) |
| Keywords | Methyltransferase;Nucleus;Reference proteome;S-adenosyl-L-methionine;Sporulation;Transcription;Transcription regulation;Transferase |
| Interact With | |
| Induction | INDUCTION: Expression is negatively regulated by protein kinase A (PubMed:23390613). {ECO:0000269|PubMed:23390613}. |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000250|UniProtKB:C8VQG9}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 38,405 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:60560; RHEA:60561 |
| Cross Reference Brenda |