| IED ID | IndEnz0008000109 |
| Enzyme Type ID | cellulase000109 |
| Protein Name |
Endoglucanase 1 EG1 EC 3.2.1.4 Cellulase Endo-1,4-beta-glucanase Fragment |
| Gene Name | |
| Organism | Sclerotinia sclerotiorum (White mold) (Whetzelinia sclerotiorum) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Leotiomycetes Helotiales Sclerotiniaceae Sclerotinia Sclerotinia sclerotiorum (White mold) (Whetzelinia sclerotiorum) |
| Enzyme Sequence | AXSGKLQWIGASESGAEFGQGNLPGVVGTDYTFP |
| Enzyme Length | 34 |
| Uniprot Accession Number | P21833 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Endohydrolysis of (1->4)-beta-D-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.; EC=3.2.1.4; |
| DNA Binding | |
| EC Number | 3.2.1.4 |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-terminal residue (1) |
| Keywords | Carbohydrate metabolism;Cellulose degradation;Direct protein sequencing;Glycosidase;Hydrolase;Polysaccharide degradation |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 3,453 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.2.1.4; |