| IED ID | IndEnz0008000186 |
| Enzyme Type ID | cellulase000186 |
| Protein Name |
Polysaccharide monooxygenase Cel61a Cellulase-61a Cel61a Endoglucanase-61a Glycoside hydrolase-61 GH-61 EC 1.13.-.- |
| Gene Name | Cel61a MYCTH_46583 |
| Organism | Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Sordariomycetes Sordariomycetidae Sordariales Chaetomiaceae Thermothelomyces Thermothelomyces thermophilus (Myceliophthora thermophila) Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile) |
| Enzyme Sequence | MSKASALLAGLTGAALVAAHGHVSHIVVNGVYYRNYDPTTDWYQPNPPTVIGWTAADQDNGFVEPNSFGTPDIICHKSATPGGGHATVAAGDKINIVWTPEWPESHIGPVIDYLAACNGDCETVDKSSLRWFKIDGAGYDKAAGRWAADALRANGNSWLVQIPSDLKAGNYVLRHEIIALHGAQSPNGAQAYPQCINLRVTGGGSNLPSGVAGTSLYKATDPGILFNPYVSSPDYTVPGPALIAGAASSIAQSTSVATATGTATVPGGGGANPTATTTAATSAAPSTTLRTTTTSAAQTTAPPSGDVQTKYGQCGGNGWTGPTVCAPGSSCSVLNEWYSQCL |
| Enzyme Length | 342 |
| Uniprot Accession Number | G2Q9T3 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: The presence of lignin presents a significant source of antioxidants, which probably increase the activity by trapping liberated oxidized fragments. {ECO:0000269|PubMed:22342036}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 1.13.-.- |
| Enzyme Function | FUNCTION: Enzyme involved in the degradation of lignocellulosic biomass. Hydrolyzes weakly barley beta-glucan, carboxymethyl cellulose, lichenan, wheat arabinoxylan and birchwood xylan. Stimulates the hydrolysis of lignocellulosic substrates (such as hydrothermal pretreated wheat straw or steam-pretreated spruce), when combined with other cellulolytic enzymes. Lignin is a significant source of reductant residues that probably stimulate GH-61 activity by acting as electron donors. {ECO:0000269|PubMed:22342036}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 65 degrees Celsius. {ECO:0000269|PubMed:22342036}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 8.0. {ECO:0000269|PubMed:22342036}; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Domain (1); Region (3); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Cellulose degradation;Disulfide bond;Glycosidase;Hydrolase;Oxidoreductase;Polysaccharide degradation;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 34,936 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |