| IED ID | IndEnz0008000241 |
| Enzyme Type ID | cellulase000241 |
| Protein Name |
Mannan endo-1,4-beta-mannosidase B EC 3.2.1.78 Beta-mannanase 5B Man5B Endo-beta-1,4-mannanase B |
| Gene Name | manB AN3297 |
| Organism | Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Nidulantes Emericella nidulans (Aspergillus nidulans) Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) |
| Enzyme Sequence | MRLIHAVLGLLAGAAPALVAASPAAPIGNGRDQVSKAVGRHFEIDGKVQYFAGTNCWWLGNLLNDFEVELAVSQIAETGYKVVRTWGFFGVNDPSNPGQPVYYQVLNESLYEGGLGINYGSNGIRRLDTVVSLAERYDIQLVLTFMNNWNDFGGINIYSNAFGSNATTWYTDKKSQRAYREYIKFIVNRYKGSSAIFAWELGNEPRCKGCDPSVIYNWAKSVSAYIKKLDKKHMVALGDEGWLCPPEGDGTYAYDCSEGVDFVKNLEIETLDYGTFHLYPESWGYNYSWGSEWVLQHDAIGKRFNKPVVFEEYGTPLNHTQLERPWQLTTVKETQVAADFIWQFGTVLPVEGTEWGDVNSIYYGTEEYEVLAVQHAWEMARKKVPRH |
| Enzyme Length | 387 |
| Uniprot Accession Number | Q5B833 |
| Absorption | |
| Active Site | ACT_SITE 204; /note=Proton donor/acceptor; /evidence=ECO:0000250|UniProtKB:Q99036; ACT_SITE 312; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:Q99036 |
| Activity Regulation | |
| Binding Site | BINDING 86; /note=Substrate; /evidence=ECO:0000250|UniProtKB:B4XC07; BINDING 203; /note=Substrate; /evidence=ECO:0000250|UniProtKB:B4XC07; BINDING 240; /note=Substrate; /evidence=ECO:0000250|UniProtKB:Q99036; BINDING 279; /note=Substrate; /evidence=ECO:0000250|UniProtKB:B4XC07; BINDING 283; /note=Substrate; /evidence=ECO:0000250|UniProtKB:Q99036; BINDING 342; /note=Substrate; /evidence=ECO:0000250|UniProtKB:B4XC07 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Random hydrolysis of (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans.; EC=3.2.1.78; Evidence={ECO:0000269|PubMed:16844780}; |
| DNA Binding | |
| EC Number | 3.2.1.78 |
| Enzyme Function | FUNCTION: Endo-1,4-mannanase that catalyzes the random hydrolysis of (1->4)-beta-D-mannosidic linkages in mannans and heteromannans. It is a crucial enzyme for depolymerization of seed galactomannans and wood galactoglucomannans. Active against locust bean gum and gum guar (PubMed:16844780). Also has efficient transglycosylation activity. Produces mainly mannopentaose and mannoheptaose out of mannotetraose. May even prefer sugars as acceptors instead of water (PubMed:24950755). {ECO:0000269|PubMed:16844780, ECO:0000269|PubMed:24950755}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 60 degrees Celsius. {ECO:0000269|PubMed:24950755}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 6. {ECO:0000269|PubMed:24950755}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Binding site (6); Chain (1); Disulfide bond (1); Erroneous gene model prediction (2); Glycosylation (4); Region (1); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Direct protein sequencing;Disulfide bond;Glycoprotein;Glycosidase;Hydrolase;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:Q99036}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..24; /evidence=ECO:0000269|PubMed:24950755 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 43,725 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=0.6 mg/ml for locust bean gum mannan {ECO:0000269|PubMed:24950755}; |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |