| IED ID | IndEnz0008000336 |
| Enzyme Type ID | cellulase000336 |
| Protein Name |
Endoglucanase EC 3.2.1.4 CMCase Cellulase Endo-1,4-beta-glucanase |
| Gene Name | |
| Organism | Mytilus edulis (Blue mussel) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Mollusca Bivalvia Autobranchia Pteriomorphia Mytiloida Mytiloidea Mytilidae Mytilinae Mytilus Mytilus edulis (Blue mussel) |
| Enzyme Sequence | NQKCSGNPRRYNGKSCASTTNYHDSHKGACGCGPASGDAQFGWNAGSFVAAASQMYFDSGNKGWCGQHCGQCIKLTTTGGYVPGQGGPVREGLSKTFMITNLCPNIYPNQDWCNQGSQYGGHNKYGYELHLDLENGRSQVTGMGWNNPETTWEVVNCDSEHNHDHRTPSNSMYGQCQCAHQ |
| Enzyme Length | 181 |
| Uniprot Accession Number | P82186 |
| Absorption | |
| Active Site | ACT_SITE 24; /note=Nucleophile; /evidence=ECO:0000250; ACT_SITE 132; /note=Proton donor; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Endohydrolysis of (1->4)-beta-D-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.; EC=3.2.1.4; |
| DNA Binding | |
| EC Number | 3.2.1.4 |
| Enzyme Function | FUNCTION: Active towards the soluble carboxymethylcellulose (CMC). Possesses expansin activity too. {ECO:0000269|PubMed:10931178}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 30-50 degrees Celsius.; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 4.6.; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Beta strand (9); Chain (1); Disulfide bond (6); Helix (6); Turn (4) |
| Keywords | 3D-structure;Carbohydrate metabolism;Cellulose degradation;Direct protein sequencing;Disulfide bond;Glycosidase;Hydrolase;Polysaccharide degradation |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1WC2; |
| Mapped Pubmed ID | 34893216; |
| Motif | |
| Gene Encoded By | |
| Mass | 19,711 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |