IED ID | IndEnz0008000400 |
Enzyme Type ID | cellulase000400 |
Protein Name |
Mannan endo-1,4-beta-mannosidase EC 3.2.1.78 Mannanase 5A Man5A Mannanase A ManA |
Gene Name | |
Organism | Salipaludibacillus agaradhaerens (Bacillus agaradhaerens) |
Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Salipaludibacillus Salipaludibacillus agaradhaerens (Bacillus agaradhaerens) |
Enzyme Sequence | AGFYVDGNTLYDANGQPFVMRGINHGHAWYKDTASTAIPAIAEQGANTIRIVLSDGGQWEKDDIDTIREVIELAEQNKMVAVVEVHDATGRDSRSDLNRAVDYWIEMKDALIGKEDTVIINIANEWYGSWDGSAWADGYIDVIPKLRDAGLTHTLMVDAAGWGQYPQSIHDYGQDVFNADPLKNTMFSIHMYEYAGGDANTVRSNIDRVIDQDLALVIGEFGHRHTDGDVDEDTILSYSEETGTGWLAWSWKGNSTEWDYLDLSEDWAGQHLTDWGNRIVHGADGLQETSKPSTVFTDDNGGHPEPPT |
Enzyme Length | 308 |
Uniprot Accession Number | G1K3N4 |
Absorption | |
Active Site | ACT_SITE 125; /note=Proton donor; /evidence=ECO:0000250|UniProtKB:P22533; ACT_SITE 220; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:P22533 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Random hydrolysis of (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans.; EC=3.2.1.78; Evidence={ECO:0000269|PubMed:19441796}; |
DNA Binding | |
EC Number | 3.2.1.78 |
Enzyme Function | FUNCTION: Catalyzes the endo hydrolysis of beta-1,4-linked mannan, galactomannan and glucomannan. It is able to hydrolyze mannosidic linkages that are flanked by mannose or glucose. {ECO:0000269|PubMed:19441796}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (2); Beta strand (14); Chain (1); Helix (15); Region (1); Turn (5) |
Keywords | 3D-structure;Glycosidase;Hydrolase |
Interact With | |
Induction | |
Subcellular Location | |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | X-ray crystallography (1) |
Cross Reference PDB | 2WHJ; |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 34,211 |
Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=1.8 mg/ml for galactomannan {ECO:0000269|PubMed:19441796}; KM=2.6 mg/ml for glucomannan {ECO:0000269|PubMed:19441796}; Note=kcat is 38000 min(-1) for mannanase activity with galactomannan as substrate. kcat is 45000 min(-1) for mannanase activity with glucomannan as substrate. {ECO:0000269|PubMed:19441796}; |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |