| IED ID | IndEnz0008000401 |
| Enzyme Type ID | cellulase000401 |
| Protein Name |
FAD assembly factor SdhE Antitoxin CptB DUF339 protein |
| Gene Name | sdhE cptB ygfY Ser39006_01161 |
| Organism | Serratia sp. (strain ATCC 39006) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Yersiniaceae Serratia unclassified Serratia Serratia sp. (strain ATCC 39006) |
| Enzyme Sequence | MDIDNKPRIHWACRRGMRELDISIMPFFEHDYDTLSDDDKRNFIRLLQCDDPDLFNWLMNHGEPTDQGLKHMVSLIQTRNKNRGPVAM |
| Enzyme Length | 88 |
| Uniprot Accession Number | G4V4G2 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: An FAD assembly protein, which accelerates covalent attachment of the cofactor into other proteins (PubMed:24070374, PubMed:24374335). Plays an essential role in the assembly of succinate dehydrogenase (SDH, respiratory complex II), an enzyme complex that is a component of both the tricarboxylic acid cycle and the electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Required for flavinylation (covalent attachment of FAD) of the flavoprotein subunit SdhA of SDH (PubMed:22474332). Required for flavinylation of the flavoprotein subunit FdrA of fumarate reductase (FDR) (PubMed:24374335). Flavinylation of SDH and FDR occurs in a similar but not identical manner, as site-specific mutations display subtle differences between them (PubMed:24070374, PubMed:24374335). Flavinylates SdhA in vivo in the absence of the other SDH subunits; SdhE mutants that do not flavinylate also interfere with wild-type activity in a possible dominant-negative fashion (PubMed:24070374). Weakly binds to FAD and facilitates its binding to SdhA (PubMed:22474332). Required for production of prodigiosin antibiotic (Pig); overproduction of SdhE in a deletion mutant leads to decreased synthesis of Pig compared to wild-type (PubMed:22474332). Capable of flavinylating A.pasteurianus SdhA when the SDH operon and this gene are expressed in G.oxydans; flavinylation of SdhA is detected only in the presence of sdhE (PubMed:26399411). {ECO:0000269|PubMed:22474332, ECO:0000269|PubMed:24070374, ECO:0000269|PubMed:24374335, ECO:0000269|PubMed:26399411}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Antibiotic biosynthesis; prodigiosin biosynthesis. {ECO:0000269|PubMed:22474332}. |
| nucleotide Binding | |
| Features | Chain (1); Mutagenesis (8) |
| Keywords | Antibiotic biosynthesis;Chaperone;Cytoplasm;FAD;Flavoprotein;Reference proteome |
| Interact With | |
| Induction | INDUCTION: Transcribed under both aerobic (with succinate or glucose) and anaerobic (with glycerol with or without fumarate) conditions (PubMed:24374335). Part of the sdhE-ygfX operon (PubMed:22474332). {ECO:0000269|PubMed:22474332, ECO:0000269|PubMed:24374335}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:22474332}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 10,487 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |