| IED ID | IndEnz0008000405 |
| Enzyme Type ID | cellulase000405 |
| Protein Name |
Xyloglucan-specific endo-beta-1,4-glucanase 1 EC 3.2.1.151 Glycoside hydrolase family 12 protein XEG1 GH12 protein XEG1 |
| Gene Name | XEG1 PPTG_19377 |
| Organism | Phytophthora parasitica (strain INRA-310) |
| Taxonomic Lineage | cellular organisms Eukaryota Sar Stramenopiles Oomycota Peronosporales Peronosporaceae Phytophthora Phytophthora parasitica (Potato buckeye rot agent) Phytophthora parasitica (strain INRA-310) |
| Enzyme Sequence | MKGLLAGTIAAATFAVASAGEYCGQWDWAKSTQYTVYNNLWNKNAAASGSQCTGVDKISGSTIGWHTSYTWTGGAATEVKSYSNAALIFSPKQIKNIKTIPTKMKYSYSHSSGTFVADVSYDLFTSSTATGKNEYEIMIWLAAYGGAGPISSTGKAIATVTIGSNSFKLYKGPNGSTTVFSFVATKTITNFTADLQKFLTYLVNSQGLPSSQYLITLEAGTEPFVGTNAKMTVSSYSAAVN |
| Enzyme Length | 241 |
| Uniprot Accession Number | W2PEP3 |
| Absorption | |
| Active Site | ACT_SITE 136; /evidence=ECO:0000250|UniProtKB:G4ZHR2; ACT_SITE 222; /evidence=ECO:0000250|UniProtKB:G4ZHR2 |
| Activity Regulation | ACTIVITY REGULATION: The xyloglucanase activity is inhibited by the binding of the host apoplastic glucanase inhibitor GIP2. {ECO:0000269|PubMed:28082413}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Xyloglucan + H(2)O = xyloglucan oligosaccharides.; EC=3.2.1.151; Evidence={ECO:0000305|PubMed:28082413}; |
| DNA Binding | |
| EC Number | 3.2.1.151 |
| Enzyme Function | FUNCTION: Glycoside hydrolase that exhibits xyloglucanase activity (By similarity). Acts as an important virulence factor during P.parasitica infection of its host Nicotiana benthamiana (PubMed:28082413). Also acts as a pathogen-associated molecular pattern (PAMP) in host species, where it can trigger defense responses including cell death. The PAMP activity is independent of its xyloglucanase activity (By similarity). With paralog XLP1, is required to elevate apoplastic sugar during P.parasitica infection (PubMed:28082413). {ECO:0000250|UniProtKB:G4ZHR2, ECO:0000269|PubMed:28082413}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Glycosylation (2); Mutagenesis (2); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Glycoprotein;Glycosidase;Hydrolase;Polysaccharide degradation;Reference proteome;Signal;Virulence |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,537 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |