| IED ID | IndEnz0008000406 |
| Enzyme Type ID | cellulase000406 |
| Protein Name |
Xyloglucan-specific endo-beta-1,4-glucanase 1 EC 3.2.1.151 Glycoside hydrolase family 12 protein XEG1 GH12 protein XEG1 |
| Gene Name | XEG1 PHYSODRAFT_559651 |
| Organism | Phytophthora sojae (strain P6497) (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines) |
| Taxonomic Lineage | cellular organisms Eukaryota Sar Stramenopiles Oomycota Peronosporales Peronosporaceae Phytophthora Phytophthora sojae (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines) Phytophthora sojae (strain P6497) (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines) |
| Enzyme Sequence | MKGFFAGVVAAATLAVASAGDYCGQWDWAKSTNYIVYNNLWNKNAAASGSQCTGVDKISGSTIAWHTSYTWTGGAATEVKSYSNAALVFSKKQIKNIKSIPTKMKYSYSHSSGTFVADVSYDLFTSSTASGSNEYEIMIWLAAYGGAGPISSTGKAIATVTIGSNSFKLYKGPNGSTTVFSFVATKTITNFSADLQKFLSYLTKNQGLPSSQYLITLEAGTEPFVGTNAKMTVSSFSAAVN |
| Enzyme Length | 241 |
| Uniprot Accession Number | G4ZHR2 |
| Absorption | |
| Active Site | ACT_SITE 136; /evidence=ECO:0000305|PubMed:26163574; ACT_SITE 222; /evidence=ECO:0000305|PubMed:26163574 |
| Activity Regulation | ACTIVITY REGULATION: The xyloglucanase activity is inhibited by the binding of the host apoplastic glucanase inhibitor GIP1. {ECO:0000269|PubMed:28082413}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Xyloglucan + H(2)O = xyloglucan oligosaccharides.; EC=3.2.1.151; Evidence={ECO:0000269|PubMed:26163574}; |
| DNA Binding | |
| EC Number | 3.2.1.151 |
| Enzyme Function | FUNCTION: Glycoside hydrolase that exhibits xyloglucanase activity (PubMed:26163574). Acts as an important virulence factor during P.sojae infection but also acts as a pathogen-associated molecular pattern (PAMP) in soybean and solanaceous species, where it can trigger defense responses including cell death. XEG1-induced cell death can be suppressed by P.sojae RxLR effectors. The PAMP activity is independent of its xyloglucanase activity (PubMed:26163574). XEG1 induces plant defense responses in a RLP kinase Serk3/Bak1-dependent manner in Nicotiana benthamiana. Moreover, the perception of XEG1 occurs independently of the perception of ethylene-inducing xylanase Eix2 in Tomato (PubMed:26163574). With truncated paralog XLP1, is required to elevate apoplastic sugar during P.sojae infection (PubMed:28082413). {ECO:0000269|PubMed:26163574, ECO:0000269|PubMed:28082413}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Glycosylation (2); Mutagenesis (2); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Glycoprotein;Glycosidase;Hydrolase;Polysaccharide degradation;Reference proteome;Secreted;Signal;Virulence |
| Interact With | |
| Induction | INDUCTION: Expression is strongly induced within 30 min of infection of soybean and then slowly declines. {ECO:0000269|PubMed:26163574}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:26163574, ECO:0000269|PubMed:28082413}. Host {ECO:0000269|PubMed:26163574}. Note=Targeted to the host apoplast in order to trigger cell death. {ECO:0000269|PubMed:26163574}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000269|PubMed:26163574 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,500 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |