| IED ID | IndEnz0008000473 |
| Enzyme Type ID | cellulase000473 |
| Protein Name |
Probable endo-1,4-beta-xylanase C Xylanase C EC 3.2.1.8 1,4-beta-D-xylan xylanohydrolase C |
| Gene Name | xlnC ATEG_08906 |
| Organism | Aspergillus terreus (strain NIH 2624 / FGSC A1156) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Circumdati Aspergillus terreus Aspergillus terreus (strain NIH 2624 / FGSC A1156) |
| Enzyme Sequence | MVRLTVLAGFLLTSAACSACVIGERQAAASINNAFKAKGKKYFGTCGDQGTLSDSTNSAIVKADFGQLTPENSMKWDATEPNRGQFSFGGADYLVNYATSNGKMIRGHTLVWHSQLPGWVQGITDKNTLTSVLKNHITTVMQRYKGKIYAWDVVNEIFNEDGSLRKSVFYNVLGEDFVRIAFETARSVDPQAKLYINDYNLDNANYAKTKGMADHVRKWISQGIPIDGIGSQTHLGSGGSWTVKDALNTLASSGVSEVAITELDIAGASSTDYVNVVNACLSVSKCVGITVWGVSDKYSWRSNDKPLLFDSNFQPKAAYNAIISAL |
| Enzyme Length | 326 |
| Uniprot Accession Number | Q0CBM8 |
| Absorption | |
| Active Site | ACT_SITE 156; /note=Proton donor; /evidence=ECO:0000250; ACT_SITE 262; /note=Nucleophile; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Endohydrolysis of (1->4)-beta-D-xylosidic linkages in xylans.; EC=3.2.1.8; |
| DNA Binding | |
| EC Number | 3.2.1.8 |
| Enzyme Function | FUNCTION: Endo-1,4-beta-xylanase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Glycan degradation; xylan degradation. |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Disulfide bond (1); Domain (1); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Disulfide bond;Glycosidase;Hydrolase;Polysaccharide degradation;Reference proteome;Secreted;Signal;Xylan degradation |
| Interact With | |
| Induction | INDUCTION: Expressed in presence of xylan and repressed by glucose. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 35,374 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |