| IED ID | IndEnz0008000486 |
| Enzyme Type ID | cellulase000486 |
| Protein Name |
Endo-1,4-beta-xylanase 2 Xylanase 2 EC 3.2.1.8 1,4-beta-D-xylan xylanohydrolase 2 |
| Gene Name | XYL2 XYN33 MGG_01542 |
| Organism | Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta sordariomyceta Sordariomycetes Sordariomycetidae Magnaporthales Pyriculariaceae Pyricularia Magnaporthe oryzae (Rice blast fungus) (Pyricularia oryzae) Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae) |
| Enzyme Sequence | MKASSVLLGLAPLAALAAPTPEAELSARQAQQSIDALMKAKGKLYFGTATDQGLLNTGKNSAIIKADFGQVTPENSMKWQSLENTRGQYNWAPADALVNFAVSNNKSIRGHTLIWHSQLPGWVNNINDRNQLTTVIQNHVATVMGRWKGKIRAWDVVNEIFNEDGTMRQSVFSRVLGEDFVRIAFEAARKADPNAKLYINDYNLDSPNAAKLTKGMVAHVKKWLAAGVPIDGIGSQGHLQSGQGNGLAQAIKALADSGVKEVAVTELDIQGNNANDYAAVTKGCLAVPACVGITAWGVRDNDSWRPQGNPLLFDSNYNPKAAYNSVVQALK |
| Enzyme Length | 331 |
| Uniprot Accession Number | G4MTF8 |
| Absorption | |
| Active Site | ACT_SITE 159; /note=Proton donor; /evidence=ECO:0000250; ACT_SITE 266; /note=Nucleophile; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Endohydrolysis of (1->4)-beta-D-xylosidic linkages in xylans.; EC=3.2.1.8; |
| DNA Binding | |
| EC Number | 3.2.1.8 |
| Enzyme Function | FUNCTION: Endo-1,4-beta-xylanase involved in the hydrolysis of xylan, a major structural heterogeneous polysaccharide found in plant biomass representing the second most abundant polysaccharide in the biosphere, after cellulose. Accounts for approximately 70 percent of the endoxylanase activity in the culture filtrate (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Glycan degradation; xylan degradation. |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Disulfide bond (1); Domain (1); Glycosylation (2); Signal peptide (1) |
| Keywords | Carbohydrate metabolism;Disulfide bond;Glycoprotein;Glycosidase;Hydrolase;Polysaccharide degradation;Reference proteome;Secreted;Signal;Xylan degradation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..17; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 35,681 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |